Clone GH09390 Report

Search the DGRC for GH09390

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:93
Well:90
Vector:pOT2
Associated Gene/TranscriptCG3570-RA
Protein status:GH09390.pep: gold
Preliminary Size:947
Sequenced Size:1078

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3570 2001-01-01 Release 2 assignment
CG3570 2001-07-04 Blastp of sequenced clone
CG3570 2003-01-01 Sim4 clustering to Release 3
CG3570 2008-04-29 Release 5.5 accounting
CG3570 2008-08-15 Release 5.9 accounting
CG3570 2008-12-18 5.12 accounting

Clone Sequence Records

GH09390.complete Sequence

1078 bp (1078 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051416

> GH09390.complete
ACCCACCATTTTAGTAACACCGAAGAAACGGTAGCGAAATGGCCACGGAG
GAGCACCAGCGCCTGGCCAGCATCGTGAAGAGCTGCCACGAAAGCCTGCG
CCAGTTGACTAAGGAGTATGGCGCCACAGCGGCCTGGCAGGAGCACACGA
GTCCCAGGAACGCCAAGCAACTGGCGGAGTACGCCAAGGCGATGAAGCAA
CTGGCGGCCATATGGGAGACCAACGATGGGAAGGTGGAGCTGCAGGCACG
CAGCCGCATCAAGTGGGCCATCGACTACATCACCAAGTACTTCTTTACCG
AGGGCATATATTTGCAGAAGCGCCAGCGGGAGCAGCGACTCCTGGAATCC
TACAGAGCCGAGGGAAAACTGGGCGAGGTGCAGTGCAGGCTGATGGAGGA
GCCGCCGGACAGGCTGCACGTCCTGGATGTGGGCAGCTGCTTCAATCCCT
TTTCCAGTGCTCCGCACTTGGAGGTAACCGCCCTGGACTTGTGTCCCGCC
ACCGAAGATGTGCTGCAGGCGGATTTCCTCAAAGTGGAGGTGGTACCCGG
AATACGAGAACCTGAGCTGGAGGAGGGCAGCGTAAGAAGGCTACCAGCAA
GCCACTACGAGTGCGTCATTTTCAGTTTGCTACTGGAATACATGCCCAGC
GCCGAGCAGAGACTACAGTGCTGCCTTCAGGCCTACGACCTGCTGCTGCC
CGAGGGCATCCTTGTGCTCATCACACCGGACTCCCAACATGTTGGCAAAA
ACGCCCACCTCATGAAAAACTGGCGCTACTCCCTGGCCAGGATTGGACTG
CTACGGGTACGCTTCGAGAAGTTGCCGCACATATCGTGCATGGTGTTCCG
CAAGGCCATCAGCCGGGAGCTCTCACAGCACTGGGCGAGCATTCACCGGG
AGGAGGGGATGTGCGAGGAAATTCGGATACCGCAGGACGATAGCTAGATA
AGATTCAGCCCCCATAAATCGATGTAAATATGTCCACGTCTACTTATTTA
TGGCTTAACTTATCTGTGTTAAGTGCGAGTTAATAATAATGGTTGACGAT
TTATCTACTAAAAAAAAAAAAAAAAAAA

GH09390.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:37:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG3570-RA 1060 CG3570-RA 1..1060 1..1060 5300 100 Plus
CG3570.a 1049 CG3570.a 307..1049 318..1060 3715 100 Plus
CG3570.a 1049 CG3570.a 45..306 1..262 1310 100 Plus
CG4707-RA 2395 CG4707-RA 2286..2395 1060..951 550 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:02:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 20489490..20490548 1..1059 5235 99.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:40:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:02:41
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24603612..24604671 1..1060 5300 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:58:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24604811..24605870 1..1060 5300 100 Plus
Blast to na_te.dros performed on 2019-03-15 22:02:41 has no hits.

GH09390.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:03:18 Download gff for GH09390.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 20489490..20490548 1..1059 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:30:53 Download gff for GH09390.complete
Subject Subject Range Query Range Percent Splice Strand
CG3570-RA 1..909 39..947 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:28:33 Download gff for GH09390.complete
Subject Subject Range Query Range Percent Splice Strand
CG3570-RA 1..909 39..947 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:07:24 Download gff for GH09390.complete
Subject Subject Range Query Range Percent Splice Strand
CG3570-RA 1..909 39..947 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:01:56 Download gff for GH09390.complete
Subject Subject Range Query Range Percent Splice Strand
CG3570-RA 1..909 39..947 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:10:58 Download gff for GH09390.complete
Subject Subject Range Query Range Percent Splice Strand
CG3570-RA 1..909 39..947 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:28:35 Download gff for GH09390.complete
Subject Subject Range Query Range Percent Splice Strand
CG3570-RA 1..1059 1..1059 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:28:33 Download gff for GH09390.complete
Subject Subject Range Query Range Percent Splice Strand
CG3570-RA 1..1059 1..1059 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:07:24 Download gff for GH09390.complete
Subject Subject Range Query Range Percent Splice Strand
CG3570-RA 41..1099 1..1059 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:01:56 Download gff for GH09390.complete
Subject Subject Range Query Range Percent Splice Strand
CG3570-RA 1..1059 1..1059 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:10:58 Download gff for GH09390.complete
Subject Subject Range Query Range Percent Splice Strand
CG3570-RA 41..1099 1..1059 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:03:18 Download gff for GH09390.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24603612..24604670 1..1059 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:03:18 Download gff for GH09390.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24603612..24604670 1..1059 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:03:18 Download gff for GH09390.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24603612..24604670 1..1059 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:07:24 Download gff for GH09390.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20491135..20492193 1..1059 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:39:52 Download gff for GH09390.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24604829..24605887 1..1059 100   Plus

GH09390.pep Sequence

Translation from 38 to 946

> GH09390.pep
MATEEHQRLASIVKSCHESLRQLTKEYGATAAWQEHTSPRNAKQLAEYAK
AMKQLAAIWETNDGKVELQARSRIKWAIDYITKYFFTEGIYLQKRQREQR
LLESYRAEGKLGEVQCRLMEEPPDRLHVLDVGSCFNPFSSAPHLEVTALD
LCPATEDVLQADFLKVEVVPGIREPELEEGSVRRLPASHYECVIFSLLLE
YMPSAEQRLQCCLQAYDLLLPEGILVLITPDSQHVGKNAHLMKNWRYSLA
RIGLLRVRFEKLPHISCMVFRKAISRELSQHWASIHREEGMCEEIRIPQD
DS*

GH09390.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:17:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12992-PA 302 GF12992-PA 1..302 1..302 1435 87.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:17:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22990-PA 302 GG22990-PA 1..302 1..302 1581 98.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:17:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21587-PA 300 GH21587-PA 1..299 1..301 1201 73.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:44:38
Subject Length Description Subject Range Query Range Score Percent Strand
Samtor-PA 302 CG3570-PA 1..302 1..302 1580 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:17:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19558-PA 300 GI19558-PA 1..299 1..301 1196 72.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:17:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10229-PA 302 GL10229-PA 1..302 1..302 1349 81.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:17:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17528-PA 302 GA17528-PA 1..302 1..302 1363 82.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:17:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11884-PA 302 GM11884-PA 1..302 1..302 1590 98.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:17:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11882-PA 302 GD11882-PA 1..302 1..302 1593 98.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:17:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21133-PA 300 GJ21133-PA 1..299 1..301 1217 73.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:17:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21419-PA 310 GK21419-PA 1..310 1..302 1229 72.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:17:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14427-PA 302 GE14427-PA 1..302 1..302 1581 98 Plus

GH09390.hyp Sequence

Translation from 38 to 946

> GH09390.hyp
MATEEHQRLASIVKSCHESLRQLTKEYGATAAWQEHTSPRNAKQLAEYAK
AMKQLAAIWETNDGKVELQARSRIKWAIDYITKYFFTEGIYLQKRQREQR
LLESYRAEGKLGEVQCRLMEEPPDRLHVLDVGSCFNPFSSAPHLEVTALD
LCPATEDVLQADFLKVEVVPGIREPELEEGSVRRLPASHYECVIFSLLLE
YMPSAEQRLQCCLQAYDLLLPEGILVLITPDSQHVGKNAHLMKNWRYSLA
RIGLLRVRFEKLPHISCMVFRKAISRELSQHWASIHREEGMCEEIRIPQD
DS*

GH09390.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:46:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG3570-PA 302 CG3570-PA 1..302 1..302 1580 100 Plus