Clone GH09478 Report

Search the DGRC for GH09478

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:94
Well:78
Vector:pOT2
Associated Gene/TranscriptCG4891-RA
Protein status:GH09478.pep: gold
Preliminary Size:1046
Sequenced Size:951

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4891 2001-01-01 Release 2 assignment
CG4891 2001-10-10 Blastp of sequenced clone
CG4891 2003-01-01 Sim4 clustering to Release 3
CG4891 2008-04-29 Release 5.5 accounting
CG4891 2008-08-15 Release 5.9 accounting
CG4891 2008-12-18 5.12 accounting

Clone Sequence Records

GH09478.complete Sequence

951 bp (951 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060668

> GH09478.complete
CTACATACAAATAATCAAGAATTATGAGAGAAAAGTGGAAAGCTCTGTTG
CTATTGCTTCAGCTGCTTGCTCATTTGGAATCGGGTCAAGCTATTTGGTT
TCCCTGGTACTTTCAGCGCTACGGACTAGCCCCACATTCATCCCGCCATG
GCGGAGGTCATAAGAACAACACAGACCCCGGGTCAACCTGCCCACCAGGC
TACGAAATAAAGGCATCAGTGGCAGGATTGTCTGGCGGAACGGCCGGATG
TGAACGCGTAGTTGGATCGAAAGCAGGACGCCTTTGCGACGATAATCCCG
TGTTGATGCAACTGGCGCGTCTCTATGTGGTGAGTCCTGAGAGGATTGTC
CTGCTCCTGGCGCAGCCATCACTAACCGAGTCCTGCGCCGAGATCACCGA
TGTGCTGGACAATATTCGGAACTCCATGCGCAATTGTGTCTTGGCACCGG
ATAACATATACGGAAGACTAGCTGATGGACTGAGCTACTTCCAATCGGAG
GTCTGCGTTGGTGGCGATGGCAGCAACAGGAAGCGATGCACTGGACTCCA
GGAGTCGCACAACTGCCTCAAGGAACTCCGGACGGACATGATCGAGTGCG
AGGCACCGGCTGATTGGTACGAACGCAGGAATGCCAGCAAGGTGTGCCAC
ATATTCAACGATGTTCTCGACTGTTACTATACGAGGGCAGCCTTGTTGTG
CGGACTTGAGGTTGCCAGGCAACTAAGGTCCTTCGCAGGCGACAGCATGG
GCAGAGCCATGATCCACAAGTGCGAGGTCAGCAAAAGGCTACCCCGGGTT
GATAATGCCATGCCCGTCAACGCAAGTAGTGGGGCTAGCTTAAGGTCATC
ATGGTTAGGTGCACTTATTTCATGGATTTTCGTTATTTATTTTTCAGACA
TTAAATATATTTTTGGATTATTGGTATATTAAAAAAAAAAAAAAAAAAAA
A

GH09478.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:15:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG4891-RA 936 CG4891-RA 5..936 1..932 4660 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:39:32
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 16093783..16094712 1..930 4650 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:40:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:39:31
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16095013..16095951 1..939 4680 99.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:38:58
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16095013..16095951 1..939 4680 99.8 Plus
Blast to na_te.dros performed 2019-03-15 23:39:31
Subject Length Description Subject Range Query Range Score Percent Strand
3S18 6126 3S18 DM23420 6126bp Derived from U23420 (g733531) (Rel. 48, Last updated, Version 3). 1553..1591 38..78 119 80.5 Plus

GH09478.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:40:32 Download gff for GH09478.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 16093783..16094712 1..930 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:31:04 Download gff for GH09478.complete
Subject Subject Range Query Range Percent Splice Strand
CG4891-RA 1..907 24..930 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:56:47 Download gff for GH09478.complete
Subject Subject Range Query Range Percent Splice Strand
CG4891-RA 1..907 24..930 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:07:46 Download gff for GH09478.complete
Subject Subject Range Query Range Percent Splice Strand
CG4891-RA 1..909 24..932 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:25:58 Download gff for GH09478.complete
Subject Subject Range Query Range Percent Splice Strand
CG4891-RA 1..907 24..930 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:44:29 Download gff for GH09478.complete
Subject Subject Range Query Range Percent Splice Strand
CG4891-RA 1..909 24..932 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:42:50 Download gff for GH09478.complete
Subject Subject Range Query Range Percent Splice Strand
CG4891-RA 5..934 1..930 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:56:47 Download gff for GH09478.complete
Subject Subject Range Query Range Percent Splice Strand
CG4891-RA 5..934 1..930 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:07:46 Download gff for GH09478.complete
Subject Subject Range Query Range Percent Splice Strand
CG4891-RA 17..946 1..930 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:25:58 Download gff for GH09478.complete
Subject Subject Range Query Range Percent Splice Strand
CG4891-RA 5..934 1..930 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:44:29 Download gff for GH09478.complete
Subject Subject Range Query Range Percent Splice Strand
CG4891-RA 17..946 1..930 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:40:32 Download gff for GH09478.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16095013..16095942 1..930 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:40:32 Download gff for GH09478.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16095013..16095942 1..930 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:40:32 Download gff for GH09478.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16095013..16095942 1..930 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:07:46 Download gff for GH09478.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16095013..16095942 1..930 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:03:07 Download gff for GH09478.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16095013..16095942 1..930 100   Plus

GH09478.pep Sequence

Translation from 23 to 931

> GH09478.pep
MREKWKALLLLLQLLAHLESGQAIWFPWYFQRYGLAPHSSRHGGGHKNNT
DPGSTCPPGYEIKASVAGLSGGTAGCERVVGSKAGRLCDDNPVLMQLARL
YVVSPERIVLLLAQPSLTESCAEITDVLDNIRNSMRNCVLAPDNIYGRLA
DGLSYFQSEVCVGGDGSNRKRCTGLQESHNCLKELRTDMIECEAPADWYE
RRNASKVCHIFNDVLDCYYTRAALLCGLEVARQLRSFAGDSMGRAMIHKC
EVSKRLPRVDNAMPVNASSGASLRSSWLGALISWIFVIYFSDIKYIFGLL
VY*

GH09478.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 10:12:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14937-PA 294 GF14937-PA 9..283 8..274 958 64.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 10:12:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25190-PA 300 GG25190-PA 1..300 1..298 1344 87.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 10:12:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10396-PA 281 GH10396-PA 9..273 13..264 809 59 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:24:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG4891-PA 302 CG4891-PA 1..302 1..302 1608 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 10:12:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17375-PA 278 GI17375-PA 5..276 5..251 776 59.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 10:12:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21041-PA 303 GL21041-PA 11..298 10..287 875 59.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:12:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18505-PA 303 GA18505-PA 11..298 10..287 885 59.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 10:12:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18653-PA 273 GM18653-PA 7..273 30..297 1266 90 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 10:12:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24039-PA 273 GD24039-PA 7..273 30..297 1266 90 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 10:12:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18053-PA 313 GJ18053-PA 24..296 20..273 838 58.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 10:12:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18899-PA 302 GK18899-PA 10..300 14..290 864 55.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 10:12:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21321-PA 303 GE21321-PA 1..303 1..298 1337 86.5 Plus

GH09478.hyp Sequence

Translation from 23 to 929

> GH09478.hyp
MREKWKALLLLLQLLAHLESGQAIWFPWYFQRYGLAPHSSRHGGGHKNNT
DPGSTCPPGYEIKASVAGLSGGTAGCERVVGSKAGRLCDDNPVLMQLARL
YVVSPERIVLLLAQPSLTESCAEITDVLDNIRNSMRNCVLAPDNIYGRLA
DGLSYFQSEVCVGGDGSNRKRCTGLQESHNCLKELRTDMIECEAPADWYE
RRNASKVCHIFNDVLDCYYTRAALLCGLEVARQLRSFAGDSMGRAMIHKC
EVSKRLPRVDNAMPVNASSGASLRSSWLGALISWIFVIYFSDIKYIFGLL
VY

GH09478.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:46:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG4891-PA 302 CG4891-PA 1..302 1..302 1608 100 Plus