Clone GH09576 Report

Search the DGRC for GH09576

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:95
Well:76
Vector:pOT2
Associated Gene/TranscriptDrsl5-RA
Protein status:GH09576.pep: gold
Preliminary Size:339
Sequenced Size:375

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10812 2002-01-01 Sim4 clustering to Release 2
CG10812 2002-05-18 Blastp of sequenced clone
CG10812 2003-01-01 Sim4 clustering to Release 3
dro5 2008-04-29 Release 5.5 accounting
dro5 2008-08-15 Release 5.9 accounting
dro5 2008-12-18 5.12 accounting

Clone Sequence Records

GH09576.complete Sequence

375 bp assembled on 2006-11-09

GenBank Submission: AY118762

> GH09576.complete
CAGCACTCTGATTCAAAACCGACAACATGCAGATCAAGTTCCTGTACCTC
TTCCTGGCTGTGATGACCATCTTCATCCTGGGCGCCAAGGAAGCCGATGC
CGACTGTCTCTCTGGAAGATACGGAGGACCCTGCGCCGTCTGGGACAACG
AGACCTGTCGTCGGGTGTGCAAGGAGGAAGGACGATCCAGTGGCCACTGC
AGTCCCAGTCTGAAGTGCTGGTGCGAGGGATGCTAGGCCATCCTTCAAGG
CGCGTTGCTCTAAATTGCCGGAAAACTACTAAATGTTATAGTTTGTTGAT
AACTATAAATAAATATTAAATATATTATTGCAACGCAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAA

GH09576.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:49:13
Subject Length Description Subject Range Query Range Score Percent Strand
dro5-RA 336 dro5-RA 1..336 1..336 1680 100 Plus
Drs-RA 376 Drs-RA 103..262 76..235 560 90 Plus
dro6-RA 219 dro6-RA 4..162 27..185 390 83 Plus
dro6-RA 219 dro6-RA 162..217 179..234 145 83.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:57:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 3316215..3316550 1..336 1650 99.4 Plus
chr3L 24539361 chr3L 3369095..3369254 76..235 560 90 Plus
chr3L 24539361 chr3L 3313787..3313993 28..234 435 80.7 Plus
chr3L 24539361 chr3L 3335586..3335799 234..27 435 81.3 Minus
chr3L 24539361 chr3L 3315190..3315248 168..226 205 89.8 Plus
chr3L 24539361 chr3L 3335020..3335079 235..176 195 88.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:40:55 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:57:53
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3316809..3317147 1..339 1695 100 Plus
3L 28110227 3L 3369671..3369830 76..235 560 90 Plus
3L 28110227 3L 3314379..3314585 28..234 450 81.2 Plus
3L 28110227 3L 3336146..3336359 234..27 420 80.8 Minus
3L 28110227 3L 3315784..3315842 168..226 205 89.8 Plus
3L 28110227 3L 3335580..3335639 235..176 195 88.3 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:08:58
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 3316809..3317147 1..339 1695 100 Plus
3L 28103327 3L 3369671..3369830 76..235 560 90 Plus
3L 28103327 3L 3314379..3314585 28..234 450 81.1 Plus
3L 28103327 3L 3336201..3336359 185..27 390 83 Minus
3L 28103327 3L 3315784..3315842 168..226 205 89.8 Plus
3L 28103327 3L 3335580..3335639 235..176 195 88.3 Minus
3L 28103327 3L 3336146..3336201 234..179 145 83.9 Minus
Blast to na_te.dros performed 2019-03-16 07:57:54
Subject Length Description Subject Range Query Range Score Percent Strand
TAHRE 10463 TAHRE OSV 10463bp 4940..4967 331..304 113 89.3 Minus

GH09576.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:58:42 Download gff for GH09576.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 3316215..3316512 1..298 99 -- Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:31:12 Download gff for GH09576.complete
Subject Subject Range Query Range Percent Splice Strand
dro5-RA 1..210 27..236 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:44:11 Download gff for GH09576.complete
Subject Subject Range Query Range Percent Splice Strand
dro5-RA 1..210 27..236 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:52:56 Download gff for GH09576.complete
Subject Subject Range Query Range Percent Splice Strand
Drsl5-RA 1..210 27..236 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:24:54 Download gff for GH09576.complete
Subject Subject Range Query Range Percent Splice Strand
dro5-RA 1..210 27..236 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:46:58 Download gff for GH09576.complete
Subject Subject Range Query Range Percent Splice Strand
Drsl5-RA 1..210 27..236 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:52:08 Download gff for GH09576.complete
Subject Subject Range Query Range Percent Splice Strand
dro5-RA 1..336 1..336 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:44:11 Download gff for GH09576.complete
Subject Subject Range Query Range Percent Splice Strand
dro5-RA 1..336 1..336 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:52:56 Download gff for GH09576.complete
Subject Subject Range Query Range Percent Splice Strand
Drsl5-RA 29..364 1..336 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:24:54 Download gff for GH09576.complete
Subject Subject Range Query Range Percent Splice Strand
dro5-RA 1..336 1..336 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:46:58 Download gff for GH09576.complete
Subject Subject Range Query Range Percent Splice Strand
Drsl5-RA 29..364 1..336 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:58:42 Download gff for GH09576.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3316809..3317144 1..336 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:58:42 Download gff for GH09576.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3316809..3317144 1..336 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:58:42 Download gff for GH09576.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3316809..3317144 1..336 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:52:56 Download gff for GH09576.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3316809..3317144 1..336 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:58:00 Download gff for GH09576.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3316809..3317144 1..336 100   Plus

GH09576.hyp Sequence

Translation from 1 to 318

> GH09576.hyp
STLIQNRQHADQVPVPLPGCDDHLHPGRQGSRCRLSLWKIRRTLRRLGQR
DLSSGVQGGRTIQWPLQSQSEVLVRGMLGHPSRRVALNCRKTTKCYSLLI
TINKY*
Sequence GH09576.hyp has no blast hits.

GH09576.pep Sequence

Translation from 26 to 235

> GH09576.pep
MQIKFLYLFLAVMTIFILGAKEADADCLSGRYGGPCAVWDNETCRRVCKE
EGRSSGHCSPSLKCWCEGC*

GH09576.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:34:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24279-PA 69 GF24279-PA 1..69 1..69 317 82.6 Plus
Dana\GF10208-PA 69 GF10208-PA 1..69 1..69 314 81.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:34:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15129-PA 69 GG15129-PA 1..69 1..69 358 97.1 Plus
Dere\GG15135-PA 70 GG15135-PA 2..70 1..69 313 81.2 Plus
Dere\GG14261-PA 72 GG14261-PA 2..72 1..69 283 74.6 Plus
Dere\GG15126-PA 70 GG15126-PA 2..70 1..69 279 72.5 Plus
Dere\GG15127-PA 71 GG15127-PA 2..71 1..69 230 61.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:56:17
Subject Length Description Subject Range Query Range Score Percent Strand
Drsl5-PA 69 CG10812-PA 1..69 1..69 392 100 Plus
Drs-PA 70 CG10810-PA 2..70 1..69 338 82.6 Plus
Drsl2-PA 70 CG32279-PA 2..70 1..69 326 79.7 Plus
Drsl6-PA 72 CG32268-PA 2..72 1..69 316 78.9 Plus
Drsl1-PA 69 CG32274-PA 1..69 1..69 266 65.2 Plus
Drsl4-PA 71 CG32282-PA 3..71 2..69 243 63.8 Plus
Drsl3-PA 71 CG32283-PA 2..71 1..69 231 58.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:34:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14562-PA 69 GM14562-PA 1..69 1..69 353 97.1 Plus
Dsec\GM14569-PA 72 GM14569-PA 2..70 1..69 311 81.2 Plus
Dsec\GM14560-PA 70 GM14560-PA 2..70 1..69 306 79.7 Plus
Dsec\GM14055-PA 69 GM14055-PA 1..69 1..69 254 66.7 Plus
Dsec\GM14054-PA 72 GM14054-PA 2..72 1..69 240 77.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:34:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\dro5-PA 69 GD13754-PA 1..69 1..69 364 100 Plus
Dsim\Drs-PA 70 GD13760-PA 2..70 1..69 316 82.6 Plus
Dsim\dro1-PA 69 GD13331-PA 1..69 1..69 253 66.7 Plus
Dsim\dro6-PA 72 GD13330-PA 2..72 1..69 240 77.5 Plus
Dsim\dro4-PA 71 GD13753-PA 3..71 2..69 225 63.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:34:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21355-PA 69 GE21355-PA 1..69 1..69 353 95.7 Plus
Dyak\GE21361-PA 70 GE21361-PA 2..70 1..69 316 82.6 Plus
Dyak\GE20688-PA 72 GE20688-PA 2..72 1..69 288 74.6 Plus
Dyak\GE21352-PA 70 GE21352-PA 2..70 1..69 286 73.9 Plus
Dyak\GE20689-PA 69 GE20689-PA 1..69 1..69 239 60.9 Plus