Associations are from manual ordering of a clone or by a periodic analysis.
Clone Sequence Records
GH09576.complete Sequence
375 bp assembled on 2006-11-09
GenBank Submission: AY118762
> GH09576.complete
CAGCACTCTGATTCAAAACCGACAACATGCAGATCAAGTTCCTGTACCTC
TTCCTGGCTGTGATGACCATCTTCATCCTGGGCGCCAAGGAAGCCGATGC
CGACTGTCTCTCTGGAAGATACGGAGGACCCTGCGCCGTCTGGGACAACG
AGACCTGTCGTCGGGTGTGCAAGGAGGAAGGACGATCCAGTGGCCACTGC
AGTCCCAGTCTGAAGTGCTGGTGCGAGGGATGCTAGGCCATCCTTCAAGG
CGCGTTGCTCTAAATTGCCGGAAAACTACTAAATGTTATAGTTTGTTGAT
AACTATAAATAAATATTAAATATATTATTGCAACGCAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAA
GH09576.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 20:49:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
dro5-RA | 336 | dro5-RA | 1..336 | 1..336 | 1680 | 100 | Plus |
Drs-RA | 376 | Drs-RA | 103..262 | 76..235 | 560 | 90 | Plus |
dro6-RA | 219 | dro6-RA | 4..162 | 27..185 | 390 | 83 | Plus |
dro6-RA | 219 | dro6-RA | 162..217 | 179..234 | 145 | 83.9 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:57:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 3316215..3316550 | 1..336 | 1650 | 99.4 | Plus |
chr3L | 24539361 | chr3L | 3369095..3369254 | 76..235 | 560 | 90 | Plus |
chr3L | 24539361 | chr3L | 3313787..3313993 | 28..234 | 435 | 80.7 | Plus |
chr3L | 24539361 | chr3L | 3335586..3335799 | 234..27 | 435 | 81.3 | Minus |
chr3L | 24539361 | chr3L | 3315190..3315248 | 168..226 | 205 | 89.8 | Plus |
chr3L | 24539361 | chr3L | 3335020..3335079 | 235..176 | 195 | 88.3 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:40:55 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:57:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 3316809..3317147 | 1..339 | 1695 | 100 | Plus |
3L | 28110227 | 3L | 3369671..3369830 | 76..235 | 560 | 90 | Plus |
3L | 28110227 | 3L | 3314379..3314585 | 28..234 | 450 | 81.2 | Plus |
3L | 28110227 | 3L | 3336146..3336359 | 234..27 | 420 | 80.8 | Minus |
3L | 28110227 | 3L | 3315784..3315842 | 168..226 | 205 | 89.8 | Plus |
3L | 28110227 | 3L | 3335580..3335639 | 235..176 | 195 | 88.3 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:08:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 3316809..3317147 | 1..339 | 1695 | 100 | Plus |
3L | 28103327 | 3L | 3369671..3369830 | 76..235 | 560 | 90 | Plus |
3L | 28103327 | 3L | 3314379..3314585 | 28..234 | 450 | 81.1 | Plus |
3L | 28103327 | 3L | 3336201..3336359 | 185..27 | 390 | 83 | Minus |
3L | 28103327 | 3L | 3315784..3315842 | 168..226 | 205 | 89.8 | Plus |
3L | 28103327 | 3L | 3335580..3335639 | 235..176 | 195 | 88.3 | Minus |
3L | 28103327 | 3L | 3336146..3336201 | 234..179 | 145 | 83.9 | Minus |
Blast to na_te.dros performed 2019-03-16 07:57:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
TAHRE | 10463 | TAHRE OSV 10463bp | 4940..4967 | 331..304 | 113 | 89.3 | Minus |
GH09576.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:58:42 Download gff for
GH09576.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 3316215..3316512 | 1..298 | 99 | -- | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:31:12 Download gff for
GH09576.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
dro5-RA | 1..210 | 27..236 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:44:11 Download gff for
GH09576.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
dro5-RA | 1..210 | 27..236 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:52:56 Download gff for
GH09576.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Drsl5-RA | 1..210 | 27..236 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:24:54 Download gff for
GH09576.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
dro5-RA | 1..210 | 27..236 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:46:58 Download gff for
GH09576.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Drsl5-RA | 1..210 | 27..236 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:52:08 Download gff for
GH09576.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
dro5-RA | 1..336 | 1..336 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:44:11 Download gff for
GH09576.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
dro5-RA | 1..336 | 1..336 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:52:56 Download gff for
GH09576.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Drsl5-RA | 29..364 | 1..336 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:24:54 Download gff for
GH09576.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
dro5-RA | 1..336 | 1..336 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:46:58 Download gff for
GH09576.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Drsl5-RA | 29..364 | 1..336 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:58:42 Download gff for
GH09576.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3316809..3317144 | 1..336 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:58:42 Download gff for
GH09576.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3316809..3317144 | 1..336 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:58:42 Download gff for
GH09576.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3316809..3317144 | 1..336 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:52:56 Download gff for
GH09576.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 3316809..3317144 | 1..336 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:58:00 Download gff for
GH09576.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3316809..3317144 | 1..336 | 100 | | Plus |
GH09576.hyp Sequence
Translation from 1 to 318
> GH09576.hyp
STLIQNRQHADQVPVPLPGCDDHLHPGRQGSRCRLSLWKIRRTLRRLGQR
DLSSGVQGGRTIQWPLQSQSEVLVRGMLGHPSRRVALNCRKTTKCYSLLI
TINKY*
Sequence GH09576.hyp has no blast hits.
GH09576.pep Sequence
Translation from 26 to 235
> GH09576.pep
MQIKFLYLFLAVMTIFILGAKEADADCLSGRYGGPCAVWDNETCRRVCKE
EGRSSGHCSPSLKCWCEGC*
GH09576.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:34:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF24279-PA | 69 | GF24279-PA | 1..69 | 1..69 | 317 | 82.6 | Plus |
Dana\GF10208-PA | 69 | GF10208-PA | 1..69 | 1..69 | 314 | 81.2 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:34:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG15129-PA | 69 | GG15129-PA | 1..69 | 1..69 | 358 | 97.1 | Plus |
Dere\GG15135-PA | 70 | GG15135-PA | 2..70 | 1..69 | 313 | 81.2 | Plus |
Dere\GG14261-PA | 72 | GG14261-PA | 2..72 | 1..69 | 283 | 74.6 | Plus |
Dere\GG15126-PA | 70 | GG15126-PA | 2..70 | 1..69 | 279 | 72.5 | Plus |
Dere\GG15127-PA | 71 | GG15127-PA | 2..71 | 1..69 | 230 | 61.4 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:56:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Drsl5-PA | 69 | CG10812-PA | 1..69 | 1..69 | 392 | 100 | Plus |
Drs-PA | 70 | CG10810-PA | 2..70 | 1..69 | 338 | 82.6 | Plus |
Drsl2-PA | 70 | CG32279-PA | 2..70 | 1..69 | 326 | 79.7 | Plus |
Drsl6-PA | 72 | CG32268-PA | 2..72 | 1..69 | 316 | 78.9 | Plus |
Drsl1-PA | 69 | CG32274-PA | 1..69 | 1..69 | 266 | 65.2 | Plus |
Drsl4-PA | 71 | CG32282-PA | 3..71 | 2..69 | 243 | 63.8 | Plus |
Drsl3-PA | 71 | CG32283-PA | 2..71 | 1..69 | 231 | 58.6 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:34:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM14562-PA | 69 | GM14562-PA | 1..69 | 1..69 | 353 | 97.1 | Plus |
Dsec\GM14569-PA | 72 | GM14569-PA | 2..70 | 1..69 | 311 | 81.2 | Plus |
Dsec\GM14560-PA | 70 | GM14560-PA | 2..70 | 1..69 | 306 | 79.7 | Plus |
Dsec\GM14055-PA | 69 | GM14055-PA | 1..69 | 1..69 | 254 | 66.7 | Plus |
Dsec\GM14054-PA | 72 | GM14054-PA | 2..72 | 1..69 | 240 | 77.5 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:34:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\dro5-PA | 69 | GD13754-PA | 1..69 | 1..69 | 364 | 100 | Plus |
Dsim\Drs-PA | 70 | GD13760-PA | 2..70 | 1..69 | 316 | 82.6 | Plus |
Dsim\dro1-PA | 69 | GD13331-PA | 1..69 | 1..69 | 253 | 66.7 | Plus |
Dsim\dro6-PA | 72 | GD13330-PA | 2..72 | 1..69 | 240 | 77.5 | Plus |
Dsim\dro4-PA | 71 | GD13753-PA | 3..71 | 2..69 | 225 | 63.8 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:34:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE21355-PA | 69 | GE21355-PA | 1..69 | 1..69 | 353 | 95.7 | Plus |
Dyak\GE21361-PA | 70 | GE21361-PA | 2..70 | 1..69 | 316 | 82.6 | Plus |
Dyak\GE20688-PA | 72 | GE20688-PA | 2..72 | 1..69 | 288 | 74.6 | Plus |
Dyak\GE21352-PA | 70 | GE21352-PA | 2..70 | 1..69 | 286 | 73.9 | Plus |
Dyak\GE20689-PA | 69 | GE20689-PA | 1..69 | 1..69 | 239 | 60.9 | Plus |