Clone GH09638 Report

Search the DGRC for GH09638

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:96
Well:38
Vector:pOT2
Associated Gene/TranscriptWdr82-RA
Protein status:GH09638.pep: gold
Preliminary Size:1300
Sequenced Size:1090

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17293 2001-01-01 Release 2 assignment
CG17293 2003-01-01 Sim4 clustering to Release 3
CG17293 2003-04-22 Blastp of sequenced clone
CG17293 2008-04-29 Release 5.5 accounting
CG17293 2008-08-15 Release 5.9 accounting
CG17293 2008-12-18 5.12 accounting

Clone Sequence Records

GH09638.complete Sequence

1090 bp (1090 high quality bases) assembled on 2003-04-22

GenBank Submission: AY069081

> GH09638.complete
CAACAATTGAGCATATTGACAACAAAACGAAATTCGACAGGCTAAAATGA
AGATAAAACTAATAGATTCGGTGGTGCGCAGTTTTAAGGTGGCCAAGATC
TTCCGAGAGAACACGGACAAGATCAACGCCATCGATTTTGCGCCCAACGG
CGAACATCTAATATCCTGCAGCGAGGATGACCAGATCGTGATCTACGACT
GCGAAAAGGGGACGCAGTCGCGCACGGTGAACTCGAAGAAGTATGGAGTG
GATTTAATCCACTTTACGCACGCCAACAACACGGCCATCCATAGCTCCAC
CAAGGTGGACGACACCATACGCTATCTCAGCCTGCACGACAACAAATATC
TGCGCTACTTCCCCGGCCACACCAAGAAGGTTATCTCGCTGTGCATTTCG
CCGGTGGAGGACACCTTTCTCTCCGGCTCGCTGGACAAGACGCTGCGCCT
GTGGGACTTGCGCTCGCCCAACTGCCAGGGACTGATGCATCTCTCTGGAC
GACCCATTGCTGCCTACGATCCCGAGGGCTTGATCTTCGCCGCTGGCGTT
AACTCGGAAAGCATTAAATTGTACGACCTTCGCTCTTTCGACAAAGGCCC
CTTCGTCACATTTAAACTTAATCAGGAGAAGGAATGCGACTGGACTGGCC
TTAAGTTCTCCCGTGACGGCAAAACAATTCTGATCAGCACGAATGGATCG
GTCATCCGGCTCGTAGATGCCTTCCACGGCACTCCGCTACAAACGTTCAC
GGGCTATCCAAACAACAAGGGCATTCCCATCGAGGCAAGCTTCAGCCCAG
ACTCGCAGTTCATCTTTTCAGGCAGCACCGATGGACGAGTGCACATCTGG
AATGCCGACACTGGCAATAAGGTGTCCGTACTGAATGGTGACCATCCGGG
ACCGGTGCAATGCGTTCAGTTCAATCCAAAATACATGATGCTGGCGTCCG
CGTGCACCAACATGGCTTTTTGGCTGCCCACATCCGAGGAGGGCTTGTAG
GCAATGATTCCCGCTTGCTTAGCTTATAAGATTACAATTTAATTTATAAA
TAATAAATCAACATAACATAAAAAAAAAAAAAAAAAAAAA

GH09638.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:44:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG17293-RA 1069 CG17293-RA 1..1069 1..1069 5345 100 Plus
CG13390.a 1274 CG13390.a 1223..1274 1072..1021 260 100 Minus
CG13390-RA 1344 CG13390-RA 1293..1344 1072..1021 260 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:50:24
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8373392..8374460 1..1069 5345 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:41:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:50:22
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8374481..8375552 1..1072 5360 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:05:23
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8374481..8375552 1..1072 5360 100 Plus
Blast to na_te.dros performed on 2019-03-15 17:50:23 has no hits.

GH09638.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:51:25 Download gff for GH09638.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8373392..8374425 1..1034 100 <- Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:31:21 Download gff for GH09638.complete
Subject Subject Range Query Range Percent Splice Strand
CG17293-RA 1..954 47..1000 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:38:40 Download gff for GH09638.complete
Subject Subject Range Query Range Percent Splice Strand
CG17293-RA 1..954 47..1000 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:48:13 Download gff for GH09638.complete
Subject Subject Range Query Range Percent Splice Strand
Wdr82-RA 1..954 47..1000 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:15:31 Download gff for GH09638.complete
Subject Subject Range Query Range Percent Splice Strand
CG17293-RA 1..954 47..1000 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:48:25 Download gff for GH09638.complete
Subject Subject Range Query Range Percent Splice Strand
Wdr82-RA 1..954 47..1000 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:43:08 Download gff for GH09638.complete
Subject Subject Range Query Range Percent Splice Strand
CG17293-RA 1..1069 1..1069 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:38:40 Download gff for GH09638.complete
Subject Subject Range Query Range Percent Splice Strand
CG17293-RA 1..1069 1..1069 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:48:13 Download gff for GH09638.complete
Subject Subject Range Query Range Percent Splice Strand
Wdr82-RA 21..1089 1..1069 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:15:31 Download gff for GH09638.complete
Subject Subject Range Query Range Percent Splice Strand
CG17293-RA 1..1069 1..1069 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:48:25 Download gff for GH09638.complete
Subject Subject Range Query Range Percent Splice Strand
Wdr82-RA 21..1089 1..1069 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:51:25 Download gff for GH09638.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8374481..8375549 1..1069 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:51:25 Download gff for GH09638.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8374481..8375549 1..1069 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:51:25 Download gff for GH09638.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8374481..8375549 1..1069 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:48:13 Download gff for GH09638.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8374481..8375549 1..1069 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:51:26 Download gff for GH09638.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8374481..8375549 1..1069 100   Plus

GH09638.hyp Sequence

Translation from 46 to 999

> GH09638.hyp
MKIKLIDSVVRSFKVAKIFRENTDKINAIDFAPNGEHLISCSEDDQIVIY
DCEKGTQSRTVNSKKYGVDLIHFTHANNTAIHSSTKVDDTIRYLSLHDNK
YLRYFPGHTKKVISLCISPVEDTFLSGSLDKTLRLWDLRSPNCQGLMHLS
GRPIAAYDPEGLIFAAGVNSESIKLYDLRSFDKGPFVTFKLNQEKECDWT
GLKFSRDGKTILISTNGSVIRLVDAFHGTPLQTFTGYPNNKGIPIEASFS
PDSQFIFSGSTDGRVHIWNADTGNKVSVLNGDHPGPVQCVQFNPKYMMLA
SACTNMAFWLPTSEEGL*

GH09638.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:47:59
Subject Length Description Subject Range Query Range Score Percent Strand
Wdr82-PA 317 CG17293-PA 1..317 1..317 1685 100 Plus
CG3515-PA 395 CG3515-PA 1..311 1..311 532 36.2 Plus
wds-PB 361 CG17437-PB 71..346 22..302 294 29.1 Plus
wds-PA 361 CG17437-PA 71..346 22..302 294 29.1 Plus
CG3436-PC 347 CG3436-PC 57..347 25..315 204 27.2 Plus
wds-PB 361 CG17437-PB 44..268 74..309 156 24 Plus
wds-PA 361 CG17437-PA 44..268 74..309 156 24 Plus

GH09638.pep Sequence

Translation from 46 to 999

> GH09638.pep
MKIKLIDSVVRSFKVAKIFRENTDKINAIDFAPNGEHLISCSEDDQIVIY
DCEKGTQSRTVNSKKYGVDLIHFTHANNTAIHSSTKVDDTIRYLSLHDNK
YLRYFPGHTKKVISLCISPVEDTFLSGSLDKTLRLWDLRSPNCQGLMHLS
GRPIAAYDPEGLIFAAGVNSESIKLYDLRSFDKGPFVTFKLNQEKECDWT
GLKFSRDGKTILISTNGSVIRLVDAFHGTPLQTFTGYPNNKGIPIEASFS
PDSQFIFSGSTDGRVHIWNADTGNKVSVLNGDHPGPVQCVQFNPKYMMLA
SACTNMAFWLPTSEEGL*

GH09638.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:55:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15223-PA 317 GF15223-PA 1..317 1..317 1700 99.7 Plus
Dana\GF20601-PA 412 GF20601-PA 1..312 1..313 543 36.6 Plus
Dana\GF22217-PA 361 GF22217-PA 57..346 8..302 291 28.4 Plus
Dana\GF13988-PA 579 GF13988-PA 293..564 26..302 287 29.2 Plus
Dana\GF13915-PA 237 GF13915-PA 12..222 88..302 210 29.2 Plus
Dana\GF22217-PA 361 GF22217-PA 45..268 83..309 151 24 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:55:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10542-PA 317 GG10542-PA 1..317 1..317 1700 99.7 Plus
Dere\GG24512-PA 394 GG24512-PA 1..312 1..313 574 37.3 Plus
Dere\GG12938-PA 361 GG12938-PA 71..346 22..302 290 29.1 Plus
Dere\GG21819-PA 343 GG21819-PA 58..334 26..308 201 24.7 Plus
Dere\GG24701-PA 347 GG24701-PA 57..347 25..315 195 27.4 Plus
Dere\GG21819-PA 343 GG21819-PA 53..250 107..309 152 27.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 21:55:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10840-PA 317 GH10840-PA 1..317 1..317 1700 99.7 Plus
Dgri\GH11495-PA 419 GH11495-PA 6..320 2..316 589 37 Plus
Dgri\GH24921-PA 357 GH24921-PA 53..342 8..302 291 28.4 Plus
Dgri\GH22022-PA 358 GH22022-PA 67..339 26..302 212 26.7 Plus
Dgri\GH11537-PA 347 GH11537-PA 57..347 25..315 198 27.3 Plus
Dgri\GH24921-PA 357 GH24921-PA 52..264 94..309 148 24.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:38:02
Subject Length Description Subject Range Query Range Score Percent Strand
Wdr82-PA 317 CG17293-PA 1..317 1..317 1685 100 Plus
CG3515-PA 395 CG3515-PA 1..311 1..311 532 36.2 Plus
wds-PB 361 CG17437-PB 71..346 22..302 294 29.1 Plus
wds-PA 361 CG17437-PA 71..346 22..302 294 29.1 Plus
CG3436-PC 347 CG3436-PC 57..347 25..315 204 27.2 Plus
CG3436-PA 347 CG3436-PA 57..347 25..315 204 27.2 Plus
CG10931-PA 345 CG10931-PA 59..335 26..308 194 24.7 Plus
Atg16-PA 419 CG31033-PA 124..410 14..305 191 25.6 Plus
Atg16-PB 445 CG31033-PB 150..436 14..305 191 25.6 Plus
Atg16-PC 604 CG31033-PC 309..595 14..305 191 25.6 Plus
Atg16-PF 612 CG31033-PF 317..603 14..305 191 25.6 Plus
CG3909-PA 331 CG3909-PA 60..285 87..314 181 27.3 Plus
Gbeta5-PA 358 CG10763-PA 59..340 12..294 172 24.6 Plus
ago-PA 1326 CG15010-PA 982..1263 11..309 172 23 Plus
ago-PB 1326 CG15010-PB 982..1263 11..309 172 23 Plus
ago-PC 1326 CG15010-PC 982..1263 11..309 172 23 Plus
Gbeta5-PA 358 CG10763-PA 112..357 23..268 166 24.4 Plus
CG3909-PA 331 CG3909-PA 52..230 121..302 164 27.8 Plus
CG8001-PD 743 CG8001-PD 324..636 26..315 163 23 Plus
CG8001-PB 743 CG8001-PB 324..636 26..315 163 23 Plus
CG8001-PC 748 CG8001-PC 329..641 26..315 163 23 Plus
CG8001-PA 748 CG8001-PA 329..641 26..315 163 23 Plus
tex-PA 320 CG9615-PA 44..271 83..316 161 26.6 Plus
Taf5-PA 704 CG7704-PA 430..648 1..227 157 27.9 Plus
wds-PB 361 CG17437-PB 44..268 74..309 156 24 Plus
wds-PA 361 CG17437-PA 44..268 74..309 156 24 Plus
Gbeta13F-PH 340 CG10545-PH 87..340 23..269 153 21.7 Plus
Gbeta13F-PG 340 CG10545-PG 87..340 23..269 153 21.7 Plus
Gbeta13F-PF 340 CG10545-PF 87..340 23..269 153 21.7 Plus
Gbeta13F-PE 340 CG10545-PE 87..340 23..269 153 21.7 Plus
Gbeta13F-PC 340 CG10545-PC 87..340 23..269 153 21.7 Plus
Gbeta13F-PA 340 CG10545-PA 87..340 23..269 153 21.7 Plus
kat80-PC 818 CG13956-PC 8..175 15..179 153 25 Plus
kat80-PA 819 CG13956-PA 8..175 15..179 153 25 Plus
kat80-PB 819 CG13956-PB 8..175 15..179 153 25 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 21:55:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17354-PA 317 GI17354-PA 1..317 1..317 1691 99.1 Plus
Dmoj\GI16991-PA 394 GI16991-PA 1..315 1..315 589 38.5 Plus
Dmoj\GI21774-PA 358 GI21774-PA 54..343 8..302 291 28.4 Plus
Dmoj\GI19111-PA 373 GI19111-PA 60..362 6..309 185 23.5 Plus
Dmoj\GI20554-PA 610 GI20554-PA 315..597 14..301 185 25.3 Plus
Dmoj\GI21774-PA 358 GI21774-PA 53..265 94..309 147 23.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:55:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25937-PA 215 GL25937-PA 1..90 1..90 467 100 Plus
Dper\GL13093-PA 356 GL13093-PA 66..341 22..302 287 29.1 Plus
Dper\GL18847-PA 347 GL18847-PA 57..347 25..315 194 26.7 Plus
Dper\GL17219-PA 345 GL17219-PA 58..330 26..302 188 24.8 Plus
Dper\GL24002-PA 598 GL24002-PA 303..585 14..301 185 25.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:55:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14445-PA 317 GA14445-PA 1..316 1..316 1684 98.1 Plus
Dpse\GA14510-PA 356 GA14510-PA 66..341 22..302 287 29.1 Plus
Dpse\GA17451-PA 347 GA17451-PA 57..347 25..315 194 26.7 Plus
Dpse\GA15952-PB 410 GA15952-PB 115..397 14..301 186 25.3 Plus
Dpse\GA10650-PB 368 GA10650-PB 81..353 26..302 184 24.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:55:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16920-PA 317 GM16920-PA 1..317 1..317 1706 100 Plus
Dsec\GM18220-PA 395 GM18220-PA 1..313 1..313 558 35.4 Plus
Dsec\GM19230-PA 361 GM19230-PA 71..346 22..302 288 29.1 Plus
Dsec\GM16719-PA 347 GM16719-PA 57..347 25..315 201 27 Plus
Dsec\GM21820-PA 353 GM21820-PA 37..328 5..302 198 24.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:55:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23532-PA 317 GD23532-PA 1..317 1..317 1706 100 Plus
Dsim\GD22827-PA 395 GD22827-PA 1..313 1..313 553 35 Plus
Dsim\GD16610-PA 361 GD16610-PA 71..346 22..302 288 29.1 Plus
Dsim\GD23005-PA 347 GD23005-PA 57..347 25..315 201 27 Plus
Dsim\GD11312-PA 353 GD11312-PA 37..328 5..302 189 24.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:55:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16174-PA 317 GJ16174-PA 1..317 1..317 1696 99.4 Plus
Dvir\GJ24160-PA 390 GJ24160-PA 1..315 3..317 614 37.5 Plus
Dvir\GJ16947-PA 358 GJ16947-PA 54..343 8..302 291 28.4 Plus
Dvir\GJ22241-PA 373 GJ22241-PA 60..362 6..309 231 26 Plus
Dvir\GJ14380-PA 322 GJ14380-PA 31..271 71..316 175 27.2 Plus
Dvir\GJ16947-PA 358 GJ16947-PA 53..265 94..309 148 23.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 21:55:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24839-PA 317 GK24839-PA 1..317 1..317 1692 98.7 Plus
Dwil\GK19997-PA 358 GK19997-PA 54..343 8..302 291 28.4 Plus
Dwil\GK23911-PA 347 GK23911-PA 57..347 25..315 193 26 Plus
Dwil\GK11448-PA 664 GK11448-PA 317..599 14..301 190 25.3 Plus
Dwil\GK19416-PA 346 GK19416-PA 57..331 26..302 179 24.6 Plus
Dwil\GK19416-PA 346 GK19416-PA 47..253 102..309 160 25 Plus
Dwil\GK19997-PA 358 GK19997-PA 53..265 94..309 149 24.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:55:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18763-PA 317 GE18763-PA 1..317 1..317 1700 99.7 Plus
Dyak\GE15087-PA 395 GE15087-PA 1..313 1..313 558 35.4 Plus
Dyak\GE16263-PA 361 GE16263-PA 71..346 22..302 290 29.1 Plus
Dyak\GE11895-PA 343 GE11895-PA 39..334 7..308 196 22.8 Plus
Dyak\GE16626-PA 347 GE16626-PA 57..342 25..310 190 27.2 Plus