Clone GH09754 Report

Search the DGRC for GH09754

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:97
Well:54
Vector:pOT2
Associated Gene/TranscriptCG9312-RA
Protein status:GH09754.pep: gold
Preliminary Size:992
Sequenced Size:806

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9312 2001-01-01 Release 2 assignment
CG9312 2003-01-01 Sim4 clustering to Release 3
CG9312 2004-06-15 Blastp of sequenced clone
CG9312 2008-04-29 Release 5.5 accounting
CG9312 2008-08-15 Release 5.9 accounting
CG9312 2008-12-18 5.12 accounting

Clone Sequence Records

GH09754.complete Sequence

806 bp (806 high quality bases) assembled on 2004-06-15

GenBank Submission: AY069082

> GH09754.complete
AAAGAGCGAGGTTCAAGCGAAACGTTCCACGAAAGATATATACGGCTAAA
GTGGTGCAGTTGTCCAAGGAATCCAGAATAGCAGTATGTTAGCCTCAGTT
GCCGCCCGTCTGGCGCTGTTCGCTGTGATAAGCACCCAGAGTCTGCAGCT
CCTCCAGGCTGCTCCGTTCCCAGGCATCGAGAATGCTGCCTTCACCAGTG
ACGATTTATTGGCCGAGGAATCGTCGCCCGTTGTTAGCCAGGTCCACGTC
CAGCACAATCGGCATCGTCGCCATCACGAGGATGGCAATTACCATGGGCA
CAGACACCATAAGCGGCACTGGGATCACCATTTTCCGGGTCCAGACTGCC
ATCACCCTGCCAGATTCGGGTTTGGATTTGAGCATGGAGGACCACCTCCC
CAAGGCCACCACCACAGATTCGAGCCACATGACTTCCAACCGTTTCCAAA
TGCCTTTGGACCACCGGAATATGAGGAGCACCGGCGGCCATTTGAAGCGC
CACTGGAGCCTTTTGAAGAAAATAAAGGGGGAATCAAGGAGCTTACAAAG
CAAGCGAGCTCAAGCAGCTTAGCTCCACCACCCGCAGCTCCAGTAACGCC
TTCCTCACGCACCAGCACCACCACCACGACAACCACCAGCACCACCAGAT
CGACTACCTTGGCACCCACCTCTTCCAGCACCGAAGAGGCACCCTTGGCC
ATCGACATACGCATCGGCTGACGAACCTAGACCTAAGGCTCCATTCTATC
TTATGCATTAAAGTGACATTAAAGTTGCTAGCCAAACCAAAAAAAAAAAA
AAAAAA

GH09754.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:01:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG9312.c 1219 CG9312.c 427..1215 1..789 3945 100 Plus
CG9312-RA 1161 CG9312-RA 151..939 1..789 3945 100 Plus
CG9312.a 857 CG9312.a 252..854 187..789 3015 100 Plus
CG9312.a 857 CG9312.a 50..235 1..186 930 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:15:06
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 9590983..9591311 190..518 1600 99.1 Plus
chr3R 27901430 chr3R 9591705..9591976 517..788 1360 100 Plus
chr3R 27901430 chr3R 9590648..9590756 1..109 545 100 Plus
chr3R 27901430 chr3R 9590818..9590894 110..186 385 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:41:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:15:05
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13766106..13766437 187..518 1660 100 Plus
3R 32079331 3R 13766832..13767104 517..789 1365 100 Plus
3R 32079331 3R 13765775..13765883 1..109 545 100 Plus
3R 32079331 3R 13765945..13766021 110..186 385 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:49:42
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 13506937..13507268 187..518 1660 100 Plus
3R 31820162 3R 13507663..13507935 517..789 1365 100 Plus
3R 31820162 3R 13506606..13506714 1..109 545 100 Plus
3R 31820162 3R 13506776..13506852 110..186 385 100 Plus
Blast to na_te.dros performed on 2019-03-16 16:15:05 has no hits.

GH09754.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:16:00 Download gff for GH09754.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 9590648..9590756 1..109 100 -> Plus
chr3R 9590818..9590894 110..186 100 -> Plus
chr3R 9590980..9591311 187..518 98 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:31:28 Download gff for GH09754.complete
Subject Subject Range Query Range Percent Splice Strand
CG9312-RA 1..636 86..721 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:36:13 Download gff for GH09754.complete
Subject Subject Range Query Range Percent Splice Strand
CG9312-RA 1..636 86..721 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:06:15 Download gff for GH09754.complete
Subject Subject Range Query Range Percent Splice Strand
CG9312-RA 1..636 86..721 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:20:03 Download gff for GH09754.complete
Subject Subject Range Query Range Percent Splice Strand
CG9312-RA 1..636 86..721 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:24:00 Download gff for GH09754.complete
Subject Subject Range Query Range Percent Splice Strand
CG9312-RA 1..636 86..721 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:43:15 Download gff for GH09754.complete
Subject Subject Range Query Range Percent Splice Strand
CG9312-RA 1..788 1..788 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:36:12 Download gff for GH09754.complete
Subject Subject Range Query Range Percent Splice Strand
CG9312-RA 1..788 1..788 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:06:15 Download gff for GH09754.complete
Subject Subject Range Query Range Percent Splice Strand
CG9312-RA 20..807 1..788 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:20:04 Download gff for GH09754.complete
Subject Subject Range Query Range Percent Splice Strand
CG9312-RA 1..788 1..788 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:24:00 Download gff for GH09754.complete
Subject Subject Range Query Range Percent Splice Strand
CG9312-RA 20..807 1..788 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:16:00 Download gff for GH09754.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13765775..13765883 1..109 100 -> Plus
3R 13765945..13766021 110..186 100 -> Plus
3R 13766106..13766437 187..518 100 -> Plus
3R 13766834..13767103 519..788 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:16:00 Download gff for GH09754.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13765775..13765883 1..109 100 -> Plus
3R 13765945..13766021 110..186 100 -> Plus
3R 13766106..13766437 187..518 100 -> Plus
3R 13766834..13767103 519..788 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:16:00 Download gff for GH09754.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13765775..13765883 1..109 100 -> Plus
3R 13765945..13766021 110..186 100 -> Plus
3R 13766106..13766437 187..518 100 -> Plus
3R 13766834..13767103 519..788 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:06:15 Download gff for GH09754.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9591497..9591605 1..109 100 -> Plus
arm_3R 9591667..9591743 110..186 100 -> Plus
arm_3R 9591828..9592159 187..518 100 -> Plus
arm_3R 9592556..9592825 519..788 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:57:20 Download gff for GH09754.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13506937..13507268 187..518 100 -> Plus
3R 13507665..13507934 519..788 100   Plus
3R 13506606..13506714 1..109 100 -> Plus
3R 13506776..13506852 110..186 100 -> Plus

GH09754.pep Sequence

Translation from 85 to 720

> GH09754.pep
MLASVAARLALFAVISTQSLQLLQAAPFPGIENAAFTSDDLLAEESSPVV
SQVHVQHNRHRRHHEDGNYHGHRHHKRHWDHHFPGPDCHHPARFGFGFEH
GGPPPQGHHHRFEPHDFQPFPNAFGPPEYEEHRRPFEAPLEPFEENKGGI
KELTKQASSSSLAPPPAAPVTPSSRTSTTTTTTTSTTRSTTLAPTSSSTE
EAPLAIDIRIG*

GH09754.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:20:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18615-PA 203 GF18615-PA 1..203 1..211 467 58.6 Plus
Dana\GF16881-PA 87 GF16881-PA 1..87 1..87 199 52.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:20:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19809-PA 211 GG19809-PA 1..211 1..211 682 84.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:48:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG9312-PA 211 CG9312-PA 1..211 1..211 1150 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:20:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23090-PA 203 GL23090-PA 1..203 1..211 304 52 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:20:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21691-PA 203 GA21691-PA 1..203 1..211 293 51.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:20:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24129-PA 214 GM24129-PA 1..214 1..211 788 88.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:20:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18928-PA 208 GD18928-PA 1..208 1..211 703 89.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:20:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26295-PA 213 GE26295-PA 1..213 1..211 784 84.5 Plus

GH09754.hyp Sequence

Translation from 85 to 720

> GH09754.hyp
MLASVAARLALFAVISTQSLQLLQAAPFPGIENAAFTSDDLLAEESSPVV
SQVHVQHNRHRRHHEDGNYHGHRHHKRHWDHHFPGPDCHHPARFGFGFEH
GGPPPQGHHHRFEPHDFQPFPNAFGPPEYEEHRRPFEAPLEPFEENKGGI
KELTKQASSSSLAPPPAAPVTPSSRTSTTTTTTTSTTRSTTLAPTSSSTE
EAPLAIDIRIG*

GH09754.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:48:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG9312-PA 211 CG9312-PA 1..211 1..211 1150 100 Plus