Clone GH09791 Report

Search the DGRC for GH09791

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:97
Well:91
Vector:pOT2
Associated Gene/TranscriptCG7448-RA
Protein status:GH09791.pep: gold
Preliminary Size:1094
Sequenced Size:958

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7448 2001-01-01 Release 2 assignment
CG7448 2002-06-10 Blastp of sequenced clone
CG7448 2003-01-01 Sim4 clustering to Release 3
CG7448 2008-04-29 Release 5.5 accounting
CG7448 2008-08-15 Release 5.9 accounting
CG7448 2008-12-18 5.12 accounting

Clone Sequence Records

GH09791.complete Sequence

958 bp (958 high quality bases) assembled on 2002-06-10

GenBank Submission: AY121621

> GH09791.complete
CACACTTTTATGACAAAAACAACAAAATCTAGTGATATTTTTACTTCTTT
CATTGAATCTGAACAATAAAGCATAAATACATTATAATGGCCCTACTATT
TCCCGATGAGCTGAAAATTTATTCACCTGACAGCATTAAAATACGGTTGC
ATTGAAGCCGCTAATAGTCACTACTTATTCTGGCAATTAAATTCTGGCTT
CTGTGGCCGTCCTAAGGTAATTTAACGTGCGAAAACTTGCGGACAGATTT
CTCCGCCGTGAATAGCTTAGCCAATTAAGGGAGCTAGACATCGCGCGAGT
GCCATTCTAAGCAGGATTGGCTGCAATTGGCGATATCGACAGCAGCATGT
TAAAGCTGGACCAATCGAAGTTGGTTTCGGGGGAGCCTAAATCCGGATCG
GGTGACATAGACATACCGAAGACGTCAGAGGAGAACCAGCTGGACGCGAT
CATCGTTGAGATTGGCCAGTTCGGACATTTTCAAGTCTTCAACTACTTGC
TGCTTTGCCTGCCCATCATCTGCAACGCCTTTTACTCCATTTCCTACGTC
TTCACCGCCAGCGATGTGCCCCACAGGTGCAACATCACAATGTGCGATGG
GTTAGACTCCAGGTATGAAGAACCATTCCTAAATTTCACCACTCCACAAC
GTCACGGCAACTGGGCTCAATGTGAGCAGTACGCCGTGCGATCCAACCTC
GTGGGTCAACCTTCGTGCAATGTCAGCAGCTTTGATGTTGGTCAGAGGGT
CCCCTGCGATGCTGGCTATAAGATGACGGACGGCGAAAAGACAATAGCAG
CTGAGTTTAACATTTTCTGCTTTGACCAGTGGAAGCTGTCAATGGTGGGA
ACCGTCAACAACATTGGACAGTTTGTGGGTTATCTAGCCAATCCGTGAGA
ATAAAGCATTTTAAGTTTCCGTCAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAA

GH09791.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:54:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG7448.a 1081 CG7448.a 1..924 1..924 4620 100 Plus
CG7448-RA 923 CG7448-RA 1..923 1..923 4615 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:37:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 21938759..21939337 1..579 2895 100 Plus
chr3L 24539361 chr3L 21939388..21939618 575..805 1155 100 Plus
chr3L 24539361 chr3L 21939669..21939788 804..923 600 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:41:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:37:40
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21949825..21950403 1..579 2895 100 Plus
3L 28110227 3L 21950454..21950684 575..805 1155 100 Plus
3L 28110227 3L 21950735..21950855 804..924 605 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:13:20
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 21942925..21943503 1..579 2895 100 Plus
3L 28103327 3L 21943554..21943784 575..805 1155 100 Plus
3L 28103327 3L 21943835..21943955 804..924 605 100 Plus
Blast to na_te.dros performed on 2019-03-15 12:37:41 has no hits.

GH09791.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:38:36 Download gff for GH09791.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 21938759..21939334 1..576 100 -> Plus
chr3L 21939390..21939618 577..805 100 -> Plus
chr3L 21939671..21939788 806..923 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:31:32 Download gff for GH09791.complete
Subject Subject Range Query Range Percent Splice Strand
CG7448-RA 1..552 347..898 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:51:10 Download gff for GH09791.complete
Subject Subject Range Query Range Percent Splice Strand
CG7448-RA 1..552 347..898 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:47:49 Download gff for GH09791.complete
Subject Subject Range Query Range Percent Splice Strand
CG7448-RA 1..552 347..898 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:33:24 Download gff for GH09791.complete
Subject Subject Range Query Range Percent Splice Strand
CG7448-RA 1..552 347..898 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:06:31 Download gff for GH09791.complete
Subject Subject Range Query Range Percent Splice Strand
CG7448-RA 1..552 347..898 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:02:20 Download gff for GH09791.complete
Subject Subject Range Query Range Percent Splice Strand
CG7448-RA 1..920 1..920 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:51:10 Download gff for GH09791.complete
Subject Subject Range Query Range Percent Splice Strand
CG7448-RA 1..920 1..920 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:47:49 Download gff for GH09791.complete
Subject Subject Range Query Range Percent Splice Strand
CG7448-RA 1..920 1..920 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:33:24 Download gff for GH09791.complete
Subject Subject Range Query Range Percent Splice Strand
CG7448-RA 1..920 1..920 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:06:31 Download gff for GH09791.complete
Subject Subject Range Query Range Percent Splice Strand
CG7448-RA 1..920 1..920 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:38:36 Download gff for GH09791.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21950737..21950854 806..923 100   Plus
3L 21949825..21950400 1..576 100 -> Plus
3L 21950456..21950684 577..805 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:38:36 Download gff for GH09791.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21950737..21950854 806..923 100   Plus
3L 21949825..21950400 1..576 100 -> Plus
3L 21950456..21950684 577..805 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:38:36 Download gff for GH09791.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21950737..21950854 806..923 100   Plus
3L 21949825..21950400 1..576 100 -> Plus
3L 21950456..21950684 577..805 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:47:49 Download gff for GH09791.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21942925..21943500 1..576 100 -> Plus
arm_3L 21943556..21943784 577..805 100 -> Plus
arm_3L 21943837..21943954 806..923 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:14:11 Download gff for GH09791.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21942925..21943500 1..576 100 -> Plus
3L 21943556..21943784 577..805 100 -> Plus
3L 21943837..21943954 806..923 100   Plus

GH09791.hyp Sequence

Translation from 346 to 897

> GH09791.hyp
MLKLDQSKLVSGEPKSGSGDIDIPKTSEENQLDAIIVEIGQFGHFQVFNY
LLLCLPIICNAFYSISYVFTASDVPHRCNITMCDGLDSRYEEPFLNFTTP
QRHGNWAQCEQYAVRSNLVGQPSCNVSSFDVGQRVPCDAGYKMTDGEKTI
AAEFNIFCFDQWKLSMVGTVNNIGQFVGYLANP*

GH09791.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:48:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG7448-PA 183 CG7448-PA 1..183 1..183 988 100 Plus
CG7448-PC 373 CG7448-PC 1..175 1..175 944 100 Plus
CG7458-PA 572 CG7458-PA 34..190 28..178 416 51.3 Plus
CG7442-PA 568 CG7442-PA 20..176 25..178 325 41.8 Plus
CG4630-PA 563 CG4630-PA 16..176 33..178 204 33.5 Plus

GH09791.pep Sequence

Translation from 346 to 897

> GH09791.pep
MLKLDQSKLVSGEPKSGSGDIDIPKTSEENQLDAIIVEIGQFGHFQVFNY
LLLCLPIICNAFYSISYVFTASDVPHRCNITMCDGLDSRYEEPFLNFTTP
QRHGNWAQCEQYAVRSNLVGQPSCNVSSFDVGQRVPCDAGYKMTDGEKTI
AAEFNIFCFDQWKLSMVGTVNNIGQFVGYLANP*

GH09791.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:58:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10936-PA 380 GF10936-PA 1..179 1..175 595 64.2 Plus
Dana\GF10937-PA 587 GF10937-PA 26..185 11..178 442 49.4 Plus
Dana\GF10934-PA 572 GF10934-PA 18..179 23..178 337 40.9 Plus
Dana\GF12962-PA 558 GF12962-PA 7..178 24..182 183 33.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:58:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16237-PA 571 GG16237-PA 34..190 28..178 403 50.3 Plus
Dere\GG16233-PA 568 GG16233-PA 8..176 14..178 304 37.9 Plus
Dere\GG22513-PA 561 GG22513-PA 15..185 32..182 207 33.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:58:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14433-PA 535 GH14433-PA 21..170 27..178 492 59.9 Plus
Dgri\GH14434-PA 599 GH14434-PA 39..205 18..178 450 53.3 Plus
Dgri\GH14431-PA 575 GH14431-PA 33..187 28..178 336 43.9 Plus
Dgri\GH22909-PA 585 GH22909-PA 11..184 33..182 167 31.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:33:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG7458-PA 572 CG7458-PA 34..190 28..178 416 51.3 Plus
SLC22A-PA 568 CG7442-PA 20..176 25..178 325 41.8 Plus
CG4630-PA 563 CG4630-PA 16..176 33..178 204 33.5 Plus
CG4630-PB 582 CG4630-PB 16..176 33..178 204 33.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:58:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13566-PA 586 GI13566-PA 31..192 23..178 424 51.5 Plus
Dmoj\GI13565-PA 554 GI13565-PA 17..166 24..178 406 50.3 Plus
Dmoj\GI13562-PA 567 GI13562-PA 27..181 28..178 347 43.9 Plus
Dmoj\GI18393-PA 577 GI18393-PA 11..173 33..182 206 34.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:58:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25415-PA 393 GL25415-PA 1..183 1..182 571 60.6 Plus
Dper\GL25416-PA 579 GL25416-PA 11..185 11..178 435 49.4 Plus
Dper\GL24806-PA 241 GL24806-PA 22..111 24..113 240 47.8 Plus
Dper\GL10508-PA 555 GL10508-PA 9..181 26..182 192 32.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:58:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20360-PA 561 GA20360-PA 1..183 1..182 577 60.6 Plus
Dpse\GA20367-PA 580 GA20367-PA 11..185 11..178 436 49.4 Plus
Dpse\GA20356-PA 608 GA20356-PA 22..219 24..178 288 33.3 Plus
Dpse\GA18316-PA 555 GA18316-PA 9..181 26..182 186 32 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:58:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22419-PA 440 GM22419-PA 1..187 1..182 870 86.1 Plus
Dsec\GM22421-PA 572 GM22421-PA 34..190 28..178 416 51.2 Plus
Dsec\GM22417-PA 568 GM22417-PA 4..176 11..178 314 38.7 Plus
Dsec\GM20299-PA 563 GM20299-PA 16..185 33..182 195 34.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:58:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15011-PA 560 GD15011-PA 1..187 1..182 876 86.1 Plus
Dsim\GD15012-PA 572 GD15012-PA 34..190 28..178 416 51.2 Plus
Dsim\GD15009-PA 568 GD15009-PA 4..176 11..178 315 39.1 Plus
Dsim\GD25780-PA 566 GD25780-PA 16..176 33..178 194 34.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:58:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13899-PA 559 GJ13899-PA 20..179 26..182 497 57.4 Plus
Dvir\GJ13900-PA 594 GJ13900-PA 44..201 28..178 420 52.5 Plus
Dvir\GJ21470-PA 577 GJ21470-PA 11..167 33..178 200 35.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:58:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10640-PA 593 GK10640-PA 25..194 28..182 470 53.5 Plus
Dwil\GK10651-PA 594 GK10651-PA 41..190 29..178 448 54.7 Plus
Dwil\GK10618-PA 570 GK10618-PA 33..182 28..178 314 42.1 Plus
Dwil\GK17890-PA 567 GK17890-PA 12..173 33..182 199 34.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:58:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22595-PA 188 GE22595-PA 1..178 1..178 788 81.5 Plus
Dyak\GE23276-PA 571 GE23276-PA 34..190 28..178 405 50.3 Plus
Dyak\GE22596-PA 571 GE22596-PA 34..190 28..178 405 50.3 Plus
Dyak\GE22593-PA 568 GE22593-PA 20..176 25..178 311 40.5 Plus
Dyak\GE13385-PA 563 GE13385-PA 15..185 32..182 205 31.8 Plus