Clone GH09825 Report

Search the DGRC for GH09825

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:98
Well:25
Vector:pOT2
Associated Gene/TranscriptCG7772-RA
Protein status:GH09825.pep: gold
Preliminary Size:842
Sequenced Size:884

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7772 2001-01-01 Release 2 assignment
CG7772 2001-07-04 Blastp of sequenced clone
CG7772 2003-01-01 Sim4 clustering to Release 3
CG7772 2008-04-29 Release 5.5 accounting
CG7772 2008-08-15 Release 5.9 accounting
CG7772 2008-12-18 5.12 accounting

Clone Sequence Records

GH09825.complete Sequence

884 bp (884 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051419

> GH09825.complete
TTTTTAAGTCTCCAATTTATAGGCAGTTAGGCGCTTTAATTATTTTATTT
AAAGCGATATTTTAAGCGATTTCAATGAATTTTTAGGAAACTCAGTTGCC
AGCTGATTTTGCGTCAGTTGGAGAAGATCAGATCATCTTGTCATATTACC
CAATTACTCGAAAATCAAAATAGCATTAGAACTTCTGCCATTCCAAAAAT
AAAAAATAAAAATAAAAAAAATAGACAATGTCGGAGGACAAACAGTTCAT
CCGCCGGGATAAGGGCACCAAGAAAACTTCCACGTCTTTGAAGGAGGTGG
ACATCTACCGGGACACCTTCATTCGCTATATGGGCTACAGCAACGAGATT
GGCGAGTCCTTCCGCCCGCTGGTGCCCAAGTCTCTGGTGGCCGCATCCTA
CGGCATGGCCATCGGATACGTCTGCACGGACACTTTTGACAAGGCACTGC
GCCTCCAAATGGAGGGCGCTTCCTCCAGAGAAGTGGCCGTCAAGGGCGGC
GACGTCTTCTGCTGGCAGATGCTGGCCTCCGTCGCCATTCCCGGCCTGGT
CATCAATCGGATCACCTGGGCCACCAAAACACTGCTGAGCAAAGCGCCTA
TGCCCGTGCTAAAGACGGTGCCCACCCTGGTGGGTCTGGCCAGCATACCG
CTTATCATCCATCCCATTGACAGCATGGTTGACCGCCTGATGGACGCCAC
CTACCGCAAGACGGTGCGGTAGTGAACGCTAGCTGGGATGTGCACAGCAT
TGGCCCAACTCCAAGTCTACTCCCATTCTACTCCACGGTGATAGTTCTTA
GATACTAAGAGTTTACATGAACTGTAGCAAAGCTTTAGCCCCAAATCCAG
TTTGCATATTGACCAGAAAAAAAAAAAAAAAAAA

GH09825.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:46:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG7772-RA 908 CG7772-RA 22..889 1..868 4340 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:49:52
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 17796301..17796635 334..1 1565 98.5 Minus
chrX 22417052 chrX 17795381..17795688 866..559 1540 100 Minus
chrX 22417052 chrX 17796002..17796229 560..333 1140 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:41:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:49:51
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 17906951..17907284 334..1 1670 100 Minus
X 23542271 X 17906029..17906338 868..559 1550 100 Minus
X 23542271 X 17906652..17906879 560..333 1140 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:07:02
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 17915049..17915382 334..1 1670 100 Minus
X 23527363 X 17914127..17914436 868..559 1550 100 Minus
X 23527363 X 17914750..17914977 560..333 1140 100 Minus
Blast to na_te.dros performed on 2019-03-16 14:49:51 has no hits.

GH09825.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:50:50 Download gff for GH09825.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 17795381..17795687 560..866 100 <- Minus
chrX 17796003..17796228 334..559 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:31:39 Download gff for GH09825.complete
Subject Subject Range Query Range Percent Splice Strand
CG7772-RA 1..495 228..722 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:41:18 Download gff for GH09825.complete
Subject Subject Range Query Range Percent Splice Strand
CG7772-RA 1..495 228..722 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:00:33 Download gff for GH09825.complete
Subject Subject Range Query Range Percent Splice Strand
CG7772-RA 1..495 228..722 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:19:36 Download gff for GH09825.complete
Subject Subject Range Query Range Percent Splice Strand
CG7772-RA 1..495 228..722 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:33:22 Download gff for GH09825.complete
Subject Subject Range Query Range Percent Splice Strand
CG7772-RA 1..495 228..722 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:47:12 Download gff for GH09825.complete
Subject Subject Range Query Range Percent Splice Strand
CG7772-RA 1..866 1..866 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:41:18 Download gff for GH09825.complete
Subject Subject Range Query Range Percent Splice Strand
CG7772-RA 1..866 1..866 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:00:33 Download gff for GH09825.complete
Subject Subject Range Query Range Percent Splice Strand
CG7772-RA 1..843 24..866 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:19:36 Download gff for GH09825.complete
Subject Subject Range Query Range Percent Splice Strand
CG7772-RA 1..866 1..866 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:33:22 Download gff for GH09825.complete
Subject Subject Range Query Range Percent Splice Strand
CG7772-RA 1..843 24..866 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:50:50 Download gff for GH09825.complete
Subject Subject Range Query Range Percent Splice Strand
X 17906031..17906337 560..866 100 <- Minus
X 17906653..17906878 334..559 100 <- Minus
X 17906952..17907284 1..333 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:50:50 Download gff for GH09825.complete
Subject Subject Range Query Range Percent Splice Strand
X 17906031..17906337 560..866 100 <- Minus
X 17906653..17906878 334..559 100 <- Minus
X 17906952..17907284 1..333 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:50:50 Download gff for GH09825.complete
Subject Subject Range Query Range Percent Splice Strand
X 17906031..17906337 560..866 100 <- Minus
X 17906653..17906878 334..559 100 <- Minus
X 17906952..17907284 1..333 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:00:33 Download gff for GH09825.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 17800064..17800370 560..866 100 <- Minus
arm_X 17800686..17800911 334..559 100 <- Minus
arm_X 17800985..17801317 1..333 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:54:32 Download gff for GH09825.complete
Subject Subject Range Query Range Percent Splice Strand
X 17914129..17914435 560..866 100 <- Minus
X 17914751..17914976 334..559 100 <- Minus
X 17915050..17915382 1..333 100   Minus

GH09825.hyp Sequence

Translation from 227 to 721

> GH09825.hyp
MSEDKQFIRRDKGTKKTSTSLKEVDIYRDTFIRYMGYSNEIGESFRPLVP
KSLVAASYGMAIGYVCTDTFDKALRLQMEGASSREVAVKGGDVFCWQMLA
SVAIPGLVINRITWATKTLLSKAPMPVLKTVPTLVGLASIPLIIHPIDSM
VDRLMDATYRKTVR*

GH09825.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:48:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG7772-PA 164 CG7772-PA 1..164 1..164 833 100 Plus

GH09825.pep Sequence

Translation from 227 to 721

> GH09825.pep
MSEDKQFIRRDKGTKKTSTSLKEVDIYRDTFIRYMGYSNEIGESFRPLVP
KSLVAASYGMAIGYVCTDTFDKALRLQMEGASSREVAVKGGDVFCWQMLA
SVAIPGLVINRITWATKTLLSKAPMPVLKTVPTLVGLASIPLIIHPIDSM
VDRLMDATYRKTVR*

GH09825.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:15:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19528-PA 169 GF19528-PA 27..169 22..164 636 81.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:15:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18153-PA 152 GG18153-PA 1..152 1..164 742 89 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:15:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17931-PA 161 GH17931-PA 13..161 16..164 596 73.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:03:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG7772-PA 164 CG7772-PA 1..164 1..164 833 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:15:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16310-PA 174 GI16310-PA 32..174 22..164 610 77.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:15:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16419-PA 161 GL16419-PA 19..161 22..164 644 81.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:15:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20577-PA 161 GA20577-PA 19..161 22..164 642 81.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:15:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22845-PA 164 GM22845-PA 1..164 1..164 838 97 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:15:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15657-PA 164 GD15657-PA 1..164 1..164 838 96.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:15:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15646-PA 171 GJ15646-PA 29..171 22..164 610 78.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:15:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16512-PA 172 GK16512-PA 30..172 22..164 646 81.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:15:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15562-PA 163 GE15562-PA 1..162 1..163 805 95.1 Plus