Clone GH09946 Report

Search the DGRC for GH09946

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:99
Well:46
Vector:pOT2
Associated Gene/TranscriptGLaz-RB
Protein status:GH09946.pep: gold
Preliminary Size:1007
Sequenced Size:865

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4604 2001-01-01 Release 2 assignment
CG4604 2002-06-11 Blastp of sequenced clone
CG4604 2003-01-01 Sim4 clustering to Release 3
GLaz 2008-04-29 Release 5.5 accounting
GLaz 2008-08-15 Release 5.9 accounting
GLaz 2008-12-18 5.12 accounting

Clone Sequence Records

GH09946.complete Sequence

865 bp (865 high quality bases) assembled on 2002-06-11

GenBank Submission: AY070838

> GH09946.complete
CCGCCTAAAGTGCCAAATATTCAAAGTGAACTATCAGAAGCAACCATGAT
GAGTGGCCAGCCACTTGGCTCGAGGGTTTGGCTGTTGTCCGGAGTGCTAT
TAGTGACATTTGCTGGGACAGATGCCTACGGATTTGGACGTTGCCCGAAT
TATCCATCGATGCCAAAGTTTAACATGAGTCGGGTCCTTGGACACTGGTA
CGAGGTAGAGCGCTCTTTTTACCTTCCGGAAATCGCCTCCGGATGCACCA
CCTTTCAGTTTGAGCCGTACAACAAGGGCGAACAATCGAAGTTTTCCAAT
TTCAAGCTGGCTGTGGCCATTAAAAACATTAATCGCATAACTGGTAATCC
GAATGTGAACATTGGCTATGCAACACCAGAAAACAGCCGATCCTCCATCA
TGGATTTTAAGTTTACCACCCGATTTCCGGACGTGATTGCCCGACTACTG
CCAGGTTCCGGAAAGTACCAGGTGCTATACACAGACTACGAGAACTTCGC
CATCTTGTGGTCCTGCGGCAGCATTGGCTCACTGGGTCACTCCGATCAGA
TCTGGATTCTTGGACGTGATCGGGACTTCGAGGTGGATATCCGATCCAAA
GTGTACGACGTGTTGAAGCGGCTCTCTCTGGATCCGGAAAGGCTCATCAT
CAGCAAAAACAAACAATGCCCCGAGGCGCTGTAGGAAGCTCCTCCAGCGT
CTCATCCCCCATCTATATGTTTAAGTTCATTCGGTTAAGGAACAAATTAC
ATTTGATGCCTAATCAATTAGGCTGCTGTGATATCGAGGAGTGTGAATCG
GCGGAGAGAGGCGAAGCAACGCAAATACAGAAACAAAAAACAAGAGTAAA
AAAAAAAAAAAAAAA

GH09946.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:20:19
Subject Length Description Subject Range Query Range Score Percent Strand
GLaz.a 1898 GLaz.a 850..1698 1..849 4245 100 Plus
GLaz-RA 1164 GLaz-RA 116..964 1..849 4245 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:23:39
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 9051387..9051824 847..410 2145 99.3 Minus
chr2R 21145070 chr2R 9053756..9053940 185..1 910 99.5 Minus
chr2R 21145070 chr2R 9052010..9052165 338..183 780 100 Minus
chr2R 21145070 chr2R 9051879..9051951 411..339 365 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:41:29 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:23:37
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 13164052..13164491 849..410 2200 100 Minus
2R 25286936 2R 13166422..13166606 185..1 925 100 Minus
2R 25286936 2R 13164677..13164832 338..183 780 100 Minus
2R 25286936 2R 13164546..13164618 411..339 365 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:59:06
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 13165251..13165690 849..410 2200 100 Minus
2R 25260384 2R 13167621..13167805 185..1 925 100 Minus
2R 25260384 2R 13165876..13166031 338..183 780 100 Minus
2R 25260384 2R 13165745..13165817 411..339 365 100 Minus
Blast to na_te.dros performed on 2019-03-16 16:23:38 has no hits.

GH09946.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:24:55 Download gff for GH09946.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 9053758..9053940 1..183 99   Minus
chr2R 9051387..9051822 412..847 99 <- Minus
chr2R 9051879..9051951 339..411 100 <- Minus
chr2R 9052010..9052164 184..338 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:31:52 Download gff for GH09946.complete
Subject Subject Range Query Range Percent Splice Strand
GLaz-RA 1..639 46..684 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:50:23 Download gff for GH09946.complete
Subject Subject Range Query Range Percent Splice Strand
GLaz-RA 1..639 46..684 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:08:36 Download gff for GH09946.complete
Subject Subject Range Query Range Percent Splice Strand
GLaz-RD 1..639 46..684 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:41:37 Download gff for GH09946.complete
Subject Subject Range Query Range Percent Splice Strand
GLaz-RA 1..639 46..684 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:25:53 Download gff for GH09946.complete
Subject Subject Range Query Range Percent Splice Strand
GLaz-RD 1..639 46..684 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:03:27 Download gff for GH09946.complete
Subject Subject Range Query Range Percent Splice Strand
GLaz-RA 1..845 1..845 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:50:23 Download gff for GH09946.complete
Subject Subject Range Query Range Percent Splice Strand
GLaz-RA 1..847 1..847 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:08:36 Download gff for GH09946.complete
Subject Subject Range Query Range Percent Splice Strand
GLaz-RD 177..1023 1..847 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:41:37 Download gff for GH09946.complete
Subject Subject Range Query Range Percent Splice Strand
GLaz-RA 1..845 1..845 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:25:53 Download gff for GH09946.complete
Subject Subject Range Query Range Percent Splice Strand
GLaz-RD 177..1023 1..847 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:24:55 Download gff for GH09946.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13164677..13164831 184..338 100 <- Minus
2R 13166424..13166606 1..183 100   Minus
2R 13164054..13164489 412..847 100 <- Minus
2R 13164546..13164618 339..411 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:24:55 Download gff for GH09946.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13164677..13164831 184..338 100 <- Minus
2R 13166424..13166606 1..183 100   Minus
2R 13164054..13164489 412..847 100 <- Minus
2R 13164546..13164618 339..411 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:24:55 Download gff for GH09946.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13164677..13164831 184..338 100 <- Minus
2R 13166424..13166606 1..183 100   Minus
2R 13164054..13164489 412..847 100 <- Minus
2R 13164546..13164618 339..411 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:08:36 Download gff for GH09946.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 9051559..9051994 412..847 100 <- Minus
arm_2R 9052051..9052123 339..411 100 <- Minus
arm_2R 9052182..9052336 184..338 100 <- Minus
arm_2R 9053929..9054111 1..183 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:12:11 Download gff for GH09946.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13165253..13165688 412..847 100 <- Minus
2R 13165745..13165817 339..411 100 <- Minus
2R 13165876..13166030 184..338 100 <- Minus
2R 13167623..13167805 1..183 100   Minus

GH09946.hyp Sequence

Translation from 1 to 683

> GH09946.hyp
PPKVPNIQSELSEATMMSGQPLGSRVWLLSGVLLVTFAGTDAYGFGRCPN
YPSMPKFNMSRVLGHWYEVERSFYLPEIASGCTTFQFEPYNKGEQSKFSN
FKLAVAIKNINRITGNPNVNIGYATPENSRSSIMDFKFTTRFPDVIARLL
PGSGKYQVLYTDYENFAILWSCGSIGSLGHSDQIWILGRDRDFEVDIRSK
VYDVLKRLSLDPERLIISKNKQCPEAL*

GH09946.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:49:36
Subject Length Description Subject Range Query Range Score Percent Strand
GLaz-PF 212 CG4604-PF 1..212 16..227 1128 100 Plus
GLaz-PE 212 CG4604-PE 1..212 16..227 1128 100 Plus
GLaz-PD 212 CG4604-PD 1..212 16..227 1128 100 Plus
GLaz-PC 212 CG4604-PC 1..212 16..227 1128 100 Plus
GLaz-PB 212 CG4604-PB 1..212 16..227 1128 100 Plus

GH09946.pep Sequence

Translation from 45 to 683

> GH09946.pep
MMSGQPLGSRVWLLSGVLLVTFAGTDAYGFGRCPNYPSMPKFNMSRVLGH
WYEVERSFYLPEIASGCTTFQFEPYNKGEQSKFSNFKLAVAIKNINRITG
NPNVNIGYATPENSRSSIMDFKFTTRFPDVIARLLPGSGKYQVLYTDYEN
FAILWSCGSIGSLGHSDQIWILGRDRDFEVDIRSKVYDVLKRLSLDPERL
IISKNKQCPEAL*

GH09946.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:24:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11979-PA 213 GF11979-PA 1..213 1..212 1028 90.1 Plus
Dana\GF14723-PA 225 GF14723-PA 10..195 10..210 170 27.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:24:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22523-PA 212 GG22523-PA 1..212 1..212 1108 97.2 Plus
Dere\GG24593-PA 217 GG24593-PA 7..191 9..209 153 25.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:24:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21588-PA 214 GH21588-PA 27..212 25..210 887 84.9 Plus
Dgri\GH10331-PA 242 GH10331-PA 54..216 31..210 162 26.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:53:55
Subject Length Description Subject Range Query Range Score Percent Strand
GLaz-PF 212 CG4604-PF 1..212 1..212 1128 100 Plus
GLaz-PE 212 CG4604-PE 1..212 1..212 1128 100 Plus
GLaz-PD 212 CG4604-PD 1..212 1..212 1128 100 Plus
GLaz-PC 212 CG4604-PC 1..212 1..212 1128 100 Plus
GLaz-PB 212 CG4604-PB 1..212 1..212 1128 100 Plus
GLaz-PA 212 CG4604-PA 1..212 1..212 1128 100 Plus
NLaz-PC 224 CG33126-PC 31..192 31..209 153 26.3 Plus
NLaz-PA 224 CG33126-PA 31..192 31..209 153 26.3 Plus
NLaz-PB 245 CG33126-PB 31..192 31..209 153 26.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:24:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19559-PA 215 GI19559-PA 26..213 23..210 873 82.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:24:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10843-PA 216 GL10843-PA 16..216 13..212 1004 93 Plus
Dper\GL14838-PA 228 GL14838-PA 12..195 1..210 183 28 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:24:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18293-PA 216 GA18293-PA 16..216 13..212 1006 93.5 Plus
Dpse\GA25349-PA 228 GA25349-PA 12..195 1..210 176 27.6 Plus
Dpse\GA22440-PA 188 GA22440-PA 1..155 39..210 162 28.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:24:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20309-PA 212 GM20309-PA 1..212 1..212 1134 99.5 Plus
Dsec\GM16611-PA 224 GM16611-PA 31..192 31..209 165 26.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:24:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18610-PA 115 GD18610-PA 1..115 98..212 608 99.1 Plus
Dsim\GD22910-PA 224 GD22910-PA 31..192 31..209 164 26.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:24:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21134-PA 214 GJ21134-PA 27..212 25..210 870 83.3 Plus
Dvir\GJ10789-PA 216 GJ10789-PA 3..190 5..210 200 29.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:24:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21632-PA 339 GK21632-PA 17..203 17..203 883 86.1 Plus
Dwil\GK14948-PA 225 GK14948-PA 29..192 31..210 156 27.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:24:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13396-PA 340 GE13396-PA 1..212 1..212 1111 96.2 Plus
Dyak\GE15611-PA 226 GE15611-PA 33..194 31..209 158 25.7 Plus