Clone GH09983 Report

Search the DGRC for GH09983

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:99
Well:83
Vector:pOT2
Associated Gene/Transcriptdj-1beta-RA
Protein status:GH09983.pep: gold
Preliminary Size:897
Sequenced Size:742

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1408 2001-01-01 Release 2 assignment
CG15544 2001-01-01 Release 2 assignment
CG11316 2001-01-01 Release 2 assignment
CG1349 2001-01-01 Release 2 assignment
CG1349 2001-10-10 Blastp of sequenced clone
CG1349 2003-01-01 Sim4 clustering to Release 3
dj-1beta 2008-04-29 Release 5.5 accounting
dj-1beta 2008-08-15 Release 5.9 accounting
dj-1beta 2008-12-18 5.12 accounting

Clone Sequence Records

GH09983.complete Sequence

742 bp (742 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060670

> GH09983.complete
ATAAGCTATCGTATCTGCATGGTTTTCTTTGGATTTCCTCAAATTTCAAG
GCACTTTTCTAAGTTTACCAAGATGTCGAAAAGCGCGCTGGTGATTTTGG
CTCCCGGAGCGGAGGAGATGGAGTTCATCATAGCCGCCGACGTTCTGAGA
AGGGCGGGCATCAAGGTCACCGTAGCCGGTTTGAATGGCGGGGAAGCGGT
GAAGTGCTCGCGGGATGTGCAGATCCTGCCGGACACCTCGCTGGCCCAGG
TTGCCTCGGATAAGTTCGATGTGGTGGTGCTGCCCGGCGGACTGGGTGGC
TCCAATGCCATGGGGGAGTCCTCGCTGGTCGGTGACTTGCTGCGCAGCCA
GGAGTCTGGTGGCGGACTCATCGCCGCCATCTGTGCCGCGCCCACCGTTT
TGGCCAAGCACGGCGTCGCCTCCGGGAAATCCCTCACCTCGTATCCCTCA
ATGAAGCCCCAGCTGGTGAATAACTATAGCTATGTGGACGACAAGACGGT
GGTCAAGGATGGCAATCTGATCACCAGTCGAGGTCCTGGCACCGCCTACG
AGTTCGCCCTCAAAATCGCCGAGGAGCTGGCGGGCAAGGAGAAAGTCCAG
GAGGTGGCCAAGGGTCTTCTTGTGGCCTACAACTAACATATTTACACTTA
TTTATGAAAACAGATTGTTTCAAGAGCAACTCATGCAAACAACAACTGAA
TTAAAATAAAATTATTCAAGACAGAAAAAAAAAAAAAAAAAA

GH09983.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:04:49
Subject Length Description Subject Range Query Range Score Percent Strand
dj-1beta-RA 1069 dj-1beta-RA 129..854 1..726 3630 100 Plus
dj-1beta.a 928 dj-1beta.a 2..466 1..465 2325 100 Plus
dj-1beta.a 928 dj-1beta.a 466..713 479..726 1240 100 Plus
DJ-1alpha.a 728 DJ-1alpha.a 378..505 338..465 175 75.7 Plus
DJ-1alpha.a 728 DJ-1alpha.a 519..574 487..542 160 85.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:24:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 26629781..26630104 160..483 1605 99.7 Plus
chr3R 27901430 chr3R 26630165..26630411 478..724 1235 100 Plus
chr3R 27901430 chr3R 26629559..26629717 1..159 795 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:41:36 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:24:36
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30807348..30807671 160..483 1605 99.7 Plus
3R 32079331 3R 30807732..30807980 478..726 1245 100 Plus
3R 32079331 3R 30807126..30807284 1..159 795 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:29:12
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 30548179..30548502 160..483 1605 99.6 Plus
3R 31820162 3R 30548563..30548811 478..726 1245 100 Plus
3R 31820162 3R 30547957..30548115 1..159 795 100 Plus
2R 25260384 2R 13944020..13944147 465..338 175 75.7 Minus
2R 25260384 2R 13943887..13943942 542..487 160 85.7 Minus
Blast to na_te.dros performed 2019-03-16 16:24:36
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy3 6973 gypsy3 GYPSY3 6973bp 1025..1080 649..706 114 69 Plus

GH09983.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:25:22 Download gff for GH09983.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 26629559..26629717 1..159 100 -> Plus
chr3R 26629781..26630100 160..479 100 -> Plus
chr3R 26630167..26630411 480..724 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:32:01 Download gff for GH09983.complete
Subject Subject Range Query Range Percent Splice Strand
dj-1beta-RA 1..618 19..636 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:40:05 Download gff for GH09983.complete
Subject Subject Range Query Range Percent Splice Strand
dj-1beta-RA 1..618 19..636 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:09:43 Download gff for GH09983.complete
Subject Subject Range Query Range Percent Splice Strand
dj-1beta-RA 1..618 19..636 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:08:56 Download gff for GH09983.complete
Subject Subject Range Query Range Percent Splice Strand
dj-1beta-RA 1..618 19..636 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:26:46 Download gff for GH09983.complete
Subject Subject Range Query Range Percent Splice Strand
dj-1beta-RA 1..618 19..636 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:21:38 Download gff for GH09983.complete
Subject Subject Range Query Range Percent Splice Strand
dj-1beta-RA 1..724 1..724 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:40:05 Download gff for GH09983.complete
Subject Subject Range Query Range Percent Splice Strand
dj-1beta-RA 1..724 1..724 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:09:43 Download gff for GH09983.complete
Subject Subject Range Query Range Percent Splice Strand
dj-1beta-RA 10..733 1..724 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:08:56 Download gff for GH09983.complete
Subject Subject Range Query Range Percent Splice Strand
dj-1beta-RA 1..724 1..724 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:26:46 Download gff for GH09983.complete
Subject Subject Range Query Range Percent Splice Strand
dj-1beta-RA 10..733 1..724 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:25:22 Download gff for GH09983.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30807348..30807667 160..479 100 -> Plus
3R 30807734..30807978 480..724 100   Plus
3R 30807126..30807284 1..159 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:25:22 Download gff for GH09983.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30807348..30807667 160..479 100 -> Plus
3R 30807734..30807978 480..724 100   Plus
3R 30807126..30807284 1..159 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:25:22 Download gff for GH09983.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30807348..30807667 160..479 100 -> Plus
3R 30807734..30807978 480..724 100   Plus
3R 30807126..30807284 1..159 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:09:43 Download gff for GH09983.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 26632848..26633006 1..159 100 -> Plus
arm_3R 26633070..26633389 160..479 100 -> Plus
arm_3R 26633456..26633700 480..724 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:45:09 Download gff for GH09983.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30548179..30548498 160..479 100 -> Plus
3R 30548565..30548809 480..724 100   Plus
3R 30547957..30548115 1..159 100 -> Plus

GH09983.hyp Sequence

Translation from 1 to 635

> GH09983.hyp
ISYRICMVFFGFPQISRHFSKFTKMSKSALVILAPGAEEMEFIIAADVLR
RAGIKVTVAGLNGGEAVKCSRDVQILPDTSLAQVASDKFDVVVLPGGLGG
SNAMGESSLVGDLLRSQESGGGLIAAICAAPTVLAKHGVASGKSLTSYPS
MKPQLVNNYSYVDDKTVVKDGNLITSRGPGTAYEFALKIAEELAGKEKVQ
EVAKGLLVAYN*

GH09983.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:50:05
Subject Length Description Subject Range Query Range Score Percent Strand
dj-1beta-PA 205 CG1349-PA 1..205 7..211 1018 100 Plus
DJ-1alpha-PA 217 CG6646-PA 18..215 14..210 622 64.6 Plus

GH09983.pep Sequence

Translation from 18 to 635

> GH09983.pep
MVFFGFPQISRHFSKFTKMSKSALVILAPGAEEMEFIIAADVLRRAGIKV
TVAGLNGGEAVKCSRDVQILPDTSLAQVASDKFDVVVLPGGLGGSNAMGE
SSLVGDLLRSQESGGGLIAAICAAPTVLAKHGVASGKSLTSYPSMKPQLV
NNYSYVDDKTVVKDGNLITSRGPGTAYEFALKIAEELAGKEKVQEVAKGL
LVAYN*

GH09983.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:38:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22924-PA 188 GF22924-PA 1..188 19..205 802 83 Plus
Dana\GF11154-PA 173 GF11154-PA 1..171 34..204 551 63.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:38:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11777-PA 187 GG11777-PA 1..187 19..205 880 89.3 Plus
Dere\GG22458-PA 217 GG22458-PA 9..216 6..205 648 61.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:38:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22956-PA 189 GH22956-PA 1..188 19..205 739 76.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:52:35
Subject Length Description Subject Range Query Range Score Percent Strand
dj-1beta-PB 187 CG1349-PB 1..187 19..205 921 100 Plus
DJ-1alpha-PA 217 CG6646-PA 18..215 8..204 622 64.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:38:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18446-PA 226 GI18446-PA 41..226 21..205 714 73.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:38:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13517-PA 187 GL13517-PA 1..187 19..205 824 84.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:38:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12322-PA 187 GA12322-PA 1..187 19..205 824 84.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:38:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12907-PA 187 GM12907-PA 1..187 19..205 947 98.9 Plus
Dsec\GM20244-PA 217 GM20244-PA 18..216 8..205 659 64.8 Plus
Dsec\GM23255-PA 217 GM23255-PA 18..216 8..205 659 64.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:38:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21547-PA 187 GD21547-PA 1..187 19..205 922 96.8 Plus
Dsim\GD25730-PA 218 GD25730-PA 9..216 6..204 649 62 Plus
Dsim\GD13461-PA 218 GD13461-PA 19..216 8..204 631 63.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:38:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21531-PA 188 GJ21531-PA 1..188 19..205 752 76.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:38:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17852-PA 189 GK17852-PA 1..186 19..204 747 77.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:38:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10903-PA 187 GE10903-PA 1..187 19..205 893 92 Plus
Dyak\GE13330-PA 217 GE13330-PA 18..215 8..204 654 63.6 Plus