BDGP Sequence Production Resources |
Search the DGRC for GH10002
Library: | GH |
Tissue Source: | Drosophila melanogaster head |
Created by: | Ling Hong |
Date Registered: | 1998-06-02 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 100 |
Well: | 2 |
Vector: | pOT2 |
Associated Gene/Transcript | CG6013-RA |
Protein status: | GH10002.pep: gold |
Preliminary Size: | 806 |
Sequenced Size: | 824 |
Gene | Date | Evidence |
---|---|---|
CG6013 | 2001-01-01 | Release 2 assignment |
CG6013 | 2001-07-04 | Blastp of sequenced clone |
CG6013 | 2003-01-01 | Sim4 clustering to Release 3 |
CG6013 | 2008-04-29 | Release 5.5 accounting |
CG6013 | 2008-08-15 | Release 5.9 accounting |
CG6013 | 2008-12-18 | 5.12 accounting |
824 bp (824 high quality bases) assembled on 2001-07-04
GenBank Submission: AY051423
> GH10002.complete TAGGATCGGAATTCATTCATAAAGGACACAATGCCAAAGAAAATGGGAAT CAACTCGAAGGCGGTGGAGGCCCGCGAGCGCAAGGAGGCCACCAAGAAGG CCACGCAGGAGAAGAAGAGCAAGGAGGCGGAGGATCGCCTGTGGCGCGAT GACGACAAGAATCTGGCCAAGAAACAACAGCGCAAGGACGAGGAGGAGCG CAAGCGGGCGGAGGCGGCCAAACGGAAGGCTGAGGCCAAAGCGCTGCTTG ACCAGGAAATGTCATCCATTAACACGCAGCGAAAGCAGCCGCTGGCCAAG ATCAACCGCCAGATGATTCTCGAGGAGATGGAGAAGAAGCAGCGCGTAAT CGAGGCGATAAACGAGGCCAACAAGCCGATGGCCGCGCGAGTGGTGGTCC AAAACCATATCGAGGAGAATCTGAACCGATCCATGGCCGACACGGATGTG GCATCCAACATTGACGAGGCCATCGTGGTGCTCAGTGTAAATGACAGCGA AGAGGACAAGCATCCCGAGAAGCGAATGCGCGCCGCCTACAAGACCTTTG AAGCCAACAATCTGCCCCGCATTAAGGCTGAGAATCCTTCCCTTCGCATG TCCCAGTGGAAGCAGCTTCTGATGAAGGAATGGAACAAGTCACCAGACAA CCCATTCAACCAGGCGCGCTAAGTGATCCAAGGACCAAGACTGTTTGCTG CCTAGCAGCAAAGAAATAATCAAAACGTTCTGTAGCACCTTTGAACTGTA CGCAGAATGTAGTATATAAAAAAAAAAGTGGACGGAATAAATTTATTTAT TTATTTAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG6013-RA | 1028 | CG6013-RA | 88..895 | 1..808 | 4040 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 14855524..14856008 | 1..485 | 99 | -> | Plus |
chr3R | 14856072..14856370 | 486..783 | 98 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6013-RA | 1..642 | 31..672 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6013-RA | 1..642 | 31..672 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6013-RA | 1..642 | 31..672 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6013-RA | 1..642 | 31..672 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6013-RA | 1..642 | 31..672 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6013-RA | 13..818 | 1..806 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6013-RA | 13..818 | 1..806 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6013-RA | 13..818 | 1..806 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6013-RA | 13..818 | 1..806 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6013-RA | 39..844 | 1..806 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 19031541..19032025 | 1..485 | 100 | -> | Plus |
3R | 19032089..19032409 | 486..806 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 19031541..19032025 | 1..485 | 100 | -> | Plus |
3R | 19032089..19032409 | 486..806 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 19031541..19032025 | 1..485 | 100 | -> | Plus |
3R | 19032089..19032409 | 486..806 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 14857263..14857747 | 1..485 | 100 | -> | Plus |
arm_3R | 14857811..14858131 | 486..806 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 18772372..18772856 | 1..485 | 100 | -> | Plus |
3R | 18772920..18773240 | 486..806 | 100 | Plus |
Translation from 30 to 671
> GH10002.pep MPKKMGINSKAVEARERKEATKKATQEKKSKEAEDRLWRDDDKNLAKKQQ RKDEEERKRAEAAKRKAEAKALLDQEMSSINTQRKQPLAKINRQMILEEM EKKQRVIEAINEANKPMAARVVVQNHIEENLNRSMADTDVASNIDEAIVV LSVNDSEEDKHPEKRMRAAYKTFEANNLPRIKAENPSLRMSQWKQLLMKE WNKSPDNPFNQAR*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF18596-PA | 213 | GF18596-PA | 1..213 | 1..213 | 974 | 90.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG23124-PA | 213 | GG23124-PA | 1..213 | 1..213 | 1071 | 98.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18160-PA | 212 | GH18160-PA | 1..212 | 1..211 | 837 | 82.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG6013-PA | 213 | CG6013-PA | 1..213 | 1..213 | 1072 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23449-PA | 213 | GI23449-PA | 1..212 | 1..212 | 810 | 84 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL23813-PA | 214 | GL23813-PA | 1..214 | 1..213 | 824 | 86.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA19295-PA | 214 | GA19295-PA | 1..214 | 1..213 | 824 | 86.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM23307-PA | 213 | GM23307-PA | 1..213 | 1..213 | 1075 | 99.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD19268-PA | 213 | GD19268-PA | 1..213 | 1..213 | 1077 | 99.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23776-PA | 214 | GJ23776-PA | 1..213 | 1..212 | 803 | 82.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK13574-PA | 214 | GK13574-PA | 1..214 | 1..213 | 893 | 80.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE25578-PA | 213 | GE25578-PA | 1..213 | 1..213 | 1057 | 97.2 | Plus |
Translation from 30 to 671
> GH10002.hyp MPKKMGINSKAVEARERKEATKKATQEKKSKEAEDRLWRDDDKNLAKKQQ RKDEEERKRAEAAKRKAEAKALLDQEMSSINTQRKQPLAKINRQMILEEM EKKQRVIEAINEANKPMAARVVVQNHIEENLNRSMADTDVASNIDEAIVV LSVNDSEEDKHPEKRMRAAYKTFEANNLPRIKAENPSLRMSQWKQLLMKE WNKSPDNPFNQAR*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG6013-PA | 213 | CG6013-PA | 1..213 | 1..213 | 1072 | 100 | Plus |