Clone GH10002 Report

Search the DGRC for GH10002

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:100
Well:2
Vector:pOT2
Associated Gene/TranscriptCG6013-RA
Protein status:GH10002.pep: gold
Preliminary Size:806
Sequenced Size:824

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6013 2001-01-01 Release 2 assignment
CG6013 2001-07-04 Blastp of sequenced clone
CG6013 2003-01-01 Sim4 clustering to Release 3
CG6013 2008-04-29 Release 5.5 accounting
CG6013 2008-08-15 Release 5.9 accounting
CG6013 2008-12-18 5.12 accounting

Clone Sequence Records

GH10002.complete Sequence

824 bp (824 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051423

> GH10002.complete
TAGGATCGGAATTCATTCATAAAGGACACAATGCCAAAGAAAATGGGAAT
CAACTCGAAGGCGGTGGAGGCCCGCGAGCGCAAGGAGGCCACCAAGAAGG
CCACGCAGGAGAAGAAGAGCAAGGAGGCGGAGGATCGCCTGTGGCGCGAT
GACGACAAGAATCTGGCCAAGAAACAACAGCGCAAGGACGAGGAGGAGCG
CAAGCGGGCGGAGGCGGCCAAACGGAAGGCTGAGGCCAAAGCGCTGCTTG
ACCAGGAAATGTCATCCATTAACACGCAGCGAAAGCAGCCGCTGGCCAAG
ATCAACCGCCAGATGATTCTCGAGGAGATGGAGAAGAAGCAGCGCGTAAT
CGAGGCGATAAACGAGGCCAACAAGCCGATGGCCGCGCGAGTGGTGGTCC
AAAACCATATCGAGGAGAATCTGAACCGATCCATGGCCGACACGGATGTG
GCATCCAACATTGACGAGGCCATCGTGGTGCTCAGTGTAAATGACAGCGA
AGAGGACAAGCATCCCGAGAAGCGAATGCGCGCCGCCTACAAGACCTTTG
AAGCCAACAATCTGCCCCGCATTAAGGCTGAGAATCCTTCCCTTCGCATG
TCCCAGTGGAAGCAGCTTCTGATGAAGGAATGGAACAAGTCACCAGACAA
CCCATTCAACCAGGCGCGCTAAGTGATCCAAGGACCAAGACTGTTTGCTG
CCTAGCAGCAAAGAAATAATCAAAACGTTCTGTAGCACCTTTGAACTGTA
CGCAGAATGTAGTATATAAAAAAAAAAGTGGACGGAATAAATTTATTTAT
TTATTTAAAAAAAAAAAAAAAAAA

GH10002.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:00:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG6013-RA 1028 CG6013-RA 88..895 1..808 4040 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:27:30
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 14855524..14856005 1..482 2380 99.6 Plus
chr3R 27901430 chr3R 14856070..14856393 484..806 1525 98.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:41:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:27:28
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 19031541..19032025 1..485 2425 100 Plus
3R 32079331 3R 19032087..19032411 484..808 1625 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:18:54
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 18772372..18772856 1..485 2425 100 Plus
3R 31820162 3R 18772918..18773242 484..808 1625 100 Plus
Blast to na_te.dros performed on 2019-03-16 00:27:29 has no hits.

GH10002.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:28:11 Download gff for GH10002.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 14855524..14856008 1..485 99 -> Plus
chr3R 14856072..14856370 486..783 98 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:32:02 Download gff for GH10002.complete
Subject Subject Range Query Range Percent Splice Strand
CG6013-RA 1..642 31..672 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:00:00 Download gff for GH10002.complete
Subject Subject Range Query Range Percent Splice Strand
CG6013-RA 1..642 31..672 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:12:21 Download gff for GH10002.complete
Subject Subject Range Query Range Percent Splice Strand
CG6013-RA 1..642 31..672 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:43:55 Download gff for GH10002.complete
Subject Subject Range Query Range Percent Splice Strand
CG6013-RA 1..642 31..672 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:01:55 Download gff for GH10002.complete
Subject Subject Range Query Range Percent Splice Strand
CG6013-RA 1..642 31..672 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:15:18 Download gff for GH10002.complete
Subject Subject Range Query Range Percent Splice Strand
CG6013-RA 13..818 1..806 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:00:00 Download gff for GH10002.complete
Subject Subject Range Query Range Percent Splice Strand
CG6013-RA 13..818 1..806 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:12:21 Download gff for GH10002.complete
Subject Subject Range Query Range Percent Splice Strand
CG6013-RA 13..818 1..806 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:43:55 Download gff for GH10002.complete
Subject Subject Range Query Range Percent Splice Strand
CG6013-RA 13..818 1..806 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:01:55 Download gff for GH10002.complete
Subject Subject Range Query Range Percent Splice Strand
CG6013-RA 39..844 1..806 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:28:11 Download gff for GH10002.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19031541..19032025 1..485 100 -> Plus
3R 19032089..19032409 486..806 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:28:11 Download gff for GH10002.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19031541..19032025 1..485 100 -> Plus
3R 19032089..19032409 486..806 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:28:11 Download gff for GH10002.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19031541..19032025 1..485 100 -> Plus
3R 19032089..19032409 486..806 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:12:21 Download gff for GH10002.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14857263..14857747 1..485 100 -> Plus
arm_3R 14857811..14858131 486..806 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:26:52 Download gff for GH10002.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18772372..18772856 1..485 100 -> Plus
3R 18772920..18773240 486..806 100   Plus

GH10002.pep Sequence

Translation from 30 to 671

> GH10002.pep
MPKKMGINSKAVEARERKEATKKATQEKKSKEAEDRLWRDDDKNLAKKQQ
RKDEEERKRAEAAKRKAEAKALLDQEMSSINTQRKQPLAKINRQMILEEM
EKKQRVIEAINEANKPMAARVVVQNHIEENLNRSMADTDVASNIDEAIVV
LSVNDSEEDKHPEKRMRAAYKTFEANNLPRIKAENPSLRMSQWKQLLMKE
WNKSPDNPFNQAR*

GH10002.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 17:09:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18596-PA 213 GF18596-PA 1..213 1..213 974 90.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 17:09:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23124-PA 213 GG23124-PA 1..213 1..213 1071 98.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 17:09:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18160-PA 212 GH18160-PA 1..212 1..211 837 82.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:43:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG6013-PA 213 CG6013-PA 1..213 1..213 1072 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 17:09:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23449-PA 213 GI23449-PA 1..212 1..212 810 84 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 17:09:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23813-PA 214 GL23813-PA 1..214 1..213 824 86.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 17:09:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19295-PA 214 GA19295-PA 1..214 1..213 824 86.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 17:09:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23307-PA 213 GM23307-PA 1..213 1..213 1075 99.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 17:09:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19268-PA 213 GD19268-PA 1..213 1..213 1077 99.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 17:09:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23776-PA 214 GJ23776-PA 1..213 1..212 803 82.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 17:09:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13574-PA 214 GK13574-PA 1..214 1..213 893 80.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 17:09:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25578-PA 213 GE25578-PA 1..213 1..213 1057 97.2 Plus

GH10002.hyp Sequence

Translation from 30 to 671

> GH10002.hyp
MPKKMGINSKAVEARERKEATKKATQEKKSKEAEDRLWRDDDKNLAKKQQ
RKDEEERKRAEAAKRKAEAKALLDQEMSSINTQRKQPLAKINRQMILEEM
EKKQRVIEAINEANKPMAARVVVQNHIEENLNRSMADTDVASNIDEAIVV
LSVNDSEEDKHPEKRMRAAYKTFEANNLPRIKAENPSLRMSQWKQLLMKE
WNKSPDNPFNQAR*

GH10002.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:50:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG6013-PA 213 CG6013-PA 1..213 1..213 1072 100 Plus