Clone GH10244 Report

Search the DGRC for GH10244

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:102
Well:44
Vector:pOT2
Associated Gene/TranscriptMpc1-RB
Protein status:GH10244.pep: gold
Preliminary Size:1300
Sequenced Size:1034

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14290 2001-01-01 Release 2 assignment
CG14290 2002-04-09 Blastp of sequenced clone
CG14290 2003-01-01 Sim4 clustering to Release 3
CG14290 2008-04-29 Release 5.5 accounting
CG14290 2008-08-15 Release 5.9 accounting
CG14290 2008-12-18 5.12 accounting

Clone Sequence Records

GH10244.complete Sequence

1034 bp (1034 high quality bases) assembled on 2002-04-09

GenBank Submission: AY095174

> GH10244.complete
TTTGACTAATTTTATATAACTTTCGGAGTGACAACACGGCCGACACATAA
ACAAAAAATATATCCTAGCTTGTGAATATTTAGGCACACACTTCACACAC
CTGCAACGCGGCCTGCAGTTCCAAATTCTTCGTGTTTTCGATCAAGGTGT
TCCAGGCGGTAAACAAACAACAGCAACAACAGCTGGCACCACAAAAACAA
CAACAACACGGCGAACAACCTGTGCGCTTCTGATTAACATTTCTGGTCAG
ATATATTCAATTAGCAAAGCGGTAGCATCATGTCGATCAGGAGAGCTATG
TCCACAACGGCCTCAAAGGAGTGGCGGGATTACTTTATGAGTACCCACTT
CTGGGGCCCGGTGGCCAACTGGGGTATTCCGGTGGCTGCTCTCGCCGACA
CACAAAAGAGTCCCAAATTCATCTCCGGCAAAATGACATTGGCTCTGACC
CTGTACTCGTGCATCTTTATGCGATTTGCCTACAAGGTCCAGCCCAGGAA
TTGGCTGCTCTTCGCCTGCCACGCTACCAATGCCACCGCCCAATCGATCC
AGGGTCTTCGCTTCCTTCACTACAATTACGGGTCTAAGGAGCAGCAGGCG
TAAATGTAATCCTTGCCCCGAAATCCACTTCCCCGAGACGCGACGCGCGA
AGCCACTTCAAATGTTTACCCAACAGCAGCAGCTATCGCAATTTACTGCC
ACCACACGCAACGAAGATCTAGCAAATTGCACTGCCGCAATCCCATTCAA
ATCAAATCCAAGTGGTGGAGTAATTGCCGTGAATCACACCCGCACAATCG
GCTGAATCTCGAATCGCGAAGTTGTCGTGCCCCAGTAGCCGTTTTCGCTG
GGGTCAAATTCCAATTCCAATTGAGTCTATACCCAACTTGTTACTTTGCC
CATTTAGTTAATTCCGTTAGGCAGTTGATCAAAATTTTAAGTCGGTGCAA
TGCTTAGATTACGATTATATGAATATGGTTTAAAATCCAATAAAAGATAT
CAAAATCTAAAAAAAAAAAAAAAAAAAAAAAAAA

GH10244.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:16:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG14290-RB 1296 CG14290-RB 143..1152 1..1010 5050 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:31:17
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 14751087..14751653 1008..442 2820 99.8 Minus
chr3R 27901430 chr3R 14752381..14752603 223..1 1055 98.2 Minus
chr3R 27901430 chr3R 14752189..14752308 341..222 600 100 Minus
chr3R 27901430 chr3R 14752022..14752124 442..340 515 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:41:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:31:15
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18927091..18927659 1010..442 2845 100 Minus
3R 32079331 3R 18928387..18928609 223..1 1115 100 Minus
3R 32079331 3R 18928195..18928314 341..222 600 100 Minus
3R 32079331 3R 18928028..18928130 442..340 515 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:46:12
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 18667922..18668490 1010..442 2845 100 Minus
3R 31820162 3R 18669218..18669440 223..1 1115 100 Minus
3R 31820162 3R 18669026..18669145 341..222 600 100 Minus
3R 31820162 3R 18668859..18668961 442..340 515 100 Minus
Blast to na_te.dros performed on 2019-03-15 21:31:16 has no hits.

GH10244.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:32:15 Download gff for GH10244.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 14751087..14751652 443..1008 99 <- Minus
chr3R 14752022..14752122 342..442 100 <- Minus
chr3R 14752189..14752308 222..341 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:32:23 Download gff for GH10244.complete
Subject Subject Range Query Range Percent Splice Strand
CG14290-RB 1..324 280..603 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:11:48 Download gff for GH10244.complete
Subject Subject Range Query Range Percent Splice Strand
CG14290-RB 1..324 280..603 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:51:19 Download gff for GH10244.complete
Subject Subject Range Query Range Percent Splice Strand
Mpc1-RB 1..324 280..603 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:56:21 Download gff for GH10244.complete
Subject Subject Range Query Range Percent Splice Strand
CG14290-RB 1..324 280..603 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:56:21 Download gff for GH10244.complete
Subject Subject Range Query Range Percent Splice Strand
Mpc1-RB 1..324 280..603 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:45:10 Download gff for GH10244.complete
Subject Subject Range Query Range Percent Splice Strand
CG14290-RB 66..1073 1..1008 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:11:47 Download gff for GH10244.complete
Subject Subject Range Query Range Percent Splice Strand
CG14290-RB 66..1073 1..1008 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:51:19 Download gff for GH10244.complete
Subject Subject Range Query Range Percent Splice Strand
Mpc1-RB 51..1058 1..1008 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:56:21 Download gff for GH10244.complete
Subject Subject Range Query Range Percent Splice Strand
CG14290-RB 66..1073 1..1008 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:56:21 Download gff for GH10244.complete
Subject Subject Range Query Range Percent Splice Strand
Mpc1-RB 51..1058 1..1008 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:32:15 Download gff for GH10244.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18927093..18927658 443..1008 100 <- Minus
3R 18928028..18928128 342..442 100 <- Minus
3R 18928195..18928314 222..341 100 <- Minus
3R 18928389..18928609 1..221 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:32:15 Download gff for GH10244.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18927093..18927658 443..1008 100 <- Minus
3R 18928028..18928128 342..442 100 <- Minus
3R 18928195..18928314 222..341 100 <- Minus
3R 18928389..18928609 1..221 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:32:15 Download gff for GH10244.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18927093..18927658 443..1008 100 <- Minus
3R 18928028..18928128 342..442 100 <- Minus
3R 18928195..18928314 222..341 100 <- Minus
3R 18928389..18928609 1..221 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:51:19 Download gff for GH10244.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14752815..14753380 443..1008 100 <- Minus
arm_3R 14753750..14753850 342..442 100 <- Minus
arm_3R 14753917..14754036 222..341 100 <- Minus
arm_3R 14754111..14754331 1..221 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:28:47 Download gff for GH10244.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18667924..18668489 443..1008 100 <- Minus
3R 18668859..18668959 342..442 100 <- Minus
3R 18669026..18669145 222..341 100 <- Minus
3R 18669220..18669440 1..221 100   Minus

GH10244.pep Sequence

Translation from 279 to 602

> GH10244.pep
MSIRRAMSTTASKEWRDYFMSTHFWGPVANWGIPVAALADTQKSPKFISG
KMTLALTLYSCIFMRFAYKVQPRNWLLFACHATNATAQSIQGLRFLHYNY
GSKEQQA*

GH10244.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 02:28:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23011-PA 107 GF23011-PA 1..105 1..105 536 91.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 02:28:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16273-PA 107 GG16273-PA 1..107 1..107 573 99.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 02:28:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18736-PA 104 GH18736-PA 1..97 1..98 457 84.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:48:32
Subject Length Description Subject Range Query Range Score Percent Strand
Mpc1-PC 107 CG14290-PC 1..107 1..107 574 100 Plus
Mpc1-PB 107 CG14290-PB 1..107 1..107 574 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 02:28:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22888-PA 108 GI22888-PA 1..106 1..104 440 75.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 02:28:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24107-PA 107 GL24107-PA 1..105 1..105 550 94.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 02:28:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12882-PA 107 GA12882-PA 1..105 1..105 550 94.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 02:28:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18673-PA 107 GM18673-PA 1..107 1..107 578 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 02:28:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20143-PA 107 GD20143-PA 1..107 1..107 578 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 02:28:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14184-PA 106 GJ14184-PA 12..98 12..98 427 86.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 02:28:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22435-PA 108 GK22435-PA 1..106 1..106 536 91.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 02:28:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25162-PA 107 GE25162-PA 1..107 1..107 572 99.1 Plus

GH10244.hyp Sequence

Translation from 279 to 602

> GH10244.hyp
MSIRRAMSTTASKEWRDYFMSTHFWGPVANWGIPVAALADTQKSPKFISG
KMTLALTLYSCIFMRFAYKVQPRNWLLFACHATNATAQSIQGLRFLHYNY
GSKEQQA*

GH10244.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:51:32
Subject Length Description Subject Range Query Range Score Percent Strand
Mpc1-PC 107 CG14290-PC 1..107 1..107 574 100 Plus
Mpc1-PB 107 CG14290-PB 1..107 1..107 574 100 Plus