Clone GH10293 Report

Search the DGRC for GH10293

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:102
Well:93
Vector:pOT2
Associated Gene/TranscriptCG6980-RA
Protein status:GH10293.pep: gold
Preliminary Size:992
Sequenced Size:915

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6980 2001-01-01 Release 2 assignment
CG6980 2002-06-12 Blastp of sequenced clone
CG6980 2003-01-01 Sim4 clustering to Release 3
CG6980 2008-04-29 Release 5.5 accounting
CG6980 2008-08-15 Release 5.9 accounting
CG6980 2008-12-18 5.12 accounting

Clone Sequence Records

GH10293.complete Sequence

915 bp (915 high quality bases) assembled on 2002-06-12

GenBank Submission: AY122104

> GH10293.complete
ATCTTAACTAAATTTCTATTCCTTACATCTTTAAAATGGCAAACGAAGAG
GTTAAAGACAATGCCCAACTTAAGGCAACTATGTTAAACTGCAATTTGAA
CCCCAGTGTCGCGGATGATTTTGCTGAGTTCGAGGCAACCCTTGCGAAGA
TCGATTGTATACTGCAGAACAAGGCACCCTGTGACGATGAAGATTCAAAG
GCAGGTGGCGATGCCAAGGAGAAGATCAACTTTGACAACTTGGATGTGGA
TAAGGTGCGGCTTAAAGTGAAAGAAAATCGAACAGTCATCAACAGAAAGT
CTCTAGAAGAAGACAATGAGAAGCAAGTCAAGGATATGAACCAGAAGAGT
TTCATGGAGCAGGTGGAGAAGGATGCCAATGATCGTGCAGAGGCACGTGC
CAAAGCCGAATACGAAGCAGAACTACAGAGAAGTCAGGGAAACGAAGCAT
TTCGCAGCCAGAAGTACGAGAAGGCAATCCTACATTATGACAAGGCTATC
ATCAAAGTTAAGGACAGCGCTATTACATATTGCAATCGCGCCTTGTGCTA
CATCAAGCTACAGAACTATAAGCGCGCCCTCAAGGACTGCCAGTACGTGT
TGGAGAAGCTGCAGGAGAGTAATCTCCGCGCCTGGCTCTACCAGGCCCAC
GCCTACAAGGGTTTGAAACAAGACGACAAGTTCGAGGAAAGCGTGGTCAA
GGCACGTGAACACAATCCCAAGCAACTGGCGTACATTGACAAGTACATTA
AGCAACTGGAAGCCGATCTTAAAGCACTAGAAATATAACTTATTTAATTT
TGCATTATATACTCACTCAGCATAAGCATGACACCCAAAAACGAGACACA
CGAATAAAGAAACGGCAGGTGAACACTGCCCAAATCTGTGAAGCATGAAA
AAAAAAAAAAAAAAA

GH10293.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:48:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG6980-RA 941 CG6980-RA 41..941 1..901 4505 100 Plus
CG5807.a 2073 CG5807.a 972..1040 885..817 345 100 Minus
CG5807-RA 2783 CG5807-RA 990..1058 885..817 345 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:13:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 20630890..20631322 1..433 2165 100 Plus
chr3R 27901430 chr3R 20631573..20631913 557..897 1645 98.8 Plus
chr3R 27901430 chr3R 20631379..20631504 432..557 615 99.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:42:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:13:44
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24807651..24808083 1..433 2165 100 Plus
3R 32079331 3R 24808337..24808681 557..901 1725 100 Plus
3R 32079331 3R 24808140..24808265 432..557 630 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:21:11
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 24548482..24548914 1..433 2165 100 Plus
3R 31820162 3R 24549168..24549512 557..901 1725 100 Plus
3R 31820162 3R 24548971..24549096 432..557 630 100 Plus
Blast to na_te.dros performed on 2019-03-15 12:13:45 has no hits.

GH10293.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:14:45 Download gff for GH10293.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 20630890..20631322 1..433 100 -> Plus
chr3R 20631381..20631503 434..556 99 -> Plus
chr3R 20631573..20631913 557..897 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:32:33 Download gff for GH10293.complete
Subject Subject Range Query Range Percent Splice Strand
CG6980-RA 1..753 36..788 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:23:30 Download gff for GH10293.complete
Subject Subject Range Query Range Percent Splice Strand
CG6980-RA 1..753 36..788 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:39:41 Download gff for GH10293.complete
Subject Subject Range Query Range Percent Splice Strand
CG6980-RA 1..753 36..788 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:14:12 Download gff for GH10293.complete
Subject Subject Range Query Range Percent Splice Strand
CG6980-RA 1..753 36..788 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:55:29 Download gff for GH10293.complete
Subject Subject Range Query Range Percent Splice Strand
CG6980-RA 1..753 36..788 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:50:37 Download gff for GH10293.complete
Subject Subject Range Query Range Percent Splice Strand
CG6980-RA 41..937 1..897 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:23:30 Download gff for GH10293.complete
Subject Subject Range Query Range Percent Splice Strand
CG6980-RA 41..937 1..897 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:39:41 Download gff for GH10293.complete
Subject Subject Range Query Range Percent Splice Strand
CG6980-RA 31..927 1..897 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:14:12 Download gff for GH10293.complete
Subject Subject Range Query Range Percent Splice Strand
CG6980-RA 41..937 1..897 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:55:29 Download gff for GH10293.complete
Subject Subject Range Query Range Percent Splice Strand
CG6980-RA 31..927 1..897 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:14:45 Download gff for GH10293.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24808142..24808264 434..556 100 -> Plus
3R 24807651..24808083 1..433 100 -> Plus
3R 24808337..24808677 557..897 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:14:45 Download gff for GH10293.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24808142..24808264 434..556 100 -> Plus
3R 24807651..24808083 1..433 100 -> Plus
3R 24808337..24808677 557..897 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:14:45 Download gff for GH10293.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24808142..24808264 434..556 100 -> Plus
3R 24807651..24808083 1..433 100 -> Plus
3R 24808337..24808677 557..897 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:39:41 Download gff for GH10293.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20633373..20633805 1..433 100 -> Plus
arm_3R 20633864..20633986 434..556 100 -> Plus
arm_3R 20634059..20634399 557..897 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:47:07 Download gff for GH10293.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24548973..24549095 434..556 100 -> Plus
3R 24549168..24549508 557..897 100   Plus
3R 24548482..24548914 1..433 100 -> Plus

GH10293.hyp Sequence

Translation from 35 to 787

> GH10293.hyp
MANEEVKDNAQLKATMLNCNLNPSVADDFAEFEATLAKIDCILQNKAPCD
DEDSKAGGDAKEKINFDNLDVDKVRLKVKENRTVINRKSLEEDNEKQVKD
MNQKSFMEQVEKDANDRAEARAKAEYEAELQRSQGNEAFRSQKYEKAILH
YDKAIIKVKDSAITYCNRALCYIKLQNYKRALKDCQYVLEKLQESNLRAW
LYQAHAYKGLKQDDKFEESVVKAREHNPKQLAYIDKYIKQLEADLKALEI
*

GH10293.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:52:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG6980-PA 250 CG6980-PA 1..250 1..250 1283 100 Plus
CG34297-PA 233 CG34297-PA 6..233 22..242 353 34.3 Plus
CG34274-PA 250 CG34274-PA 64..248 59..243 308 35.1 Plus
CG31294-PA 225 CG31294-PA 38..224 52..244 288 35.4 Plus
Hop-PA 490 CG2720-PA 264..418 93..237 175 30.8 Plus

GH10293.pep Sequence

Translation from 35 to 787

> GH10293.pep
MANEEVKDNAQLKATMLNCNLNPSVADDFAEFEATLAKIDCILQNKAPCD
DEDSKAGGDAKEKINFDNLDVDKVRLKVKENRTVINRKSLEEDNEKQVKD
MNQKSFMEQVEKDANDRAEARAKAEYEAELQRSQGNEAFRSQKYEKAILH
YDKAIIKVKDSAITYCNRALCYIKLQNYKRALKDCQYVLEKLQESNLRAW
LYQAHAYKGLKQDDKFEESVVKAREHNPKQLAYIDKYIKQLEADLKALEI
*

GH10293.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:29:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16241-PA 247 GF16241-PA 1..245 1..244 763 66.1 Plus
Dana\GF17796-PA 237 GF17796-PA 97..237 105..245 328 46.8 Plus
Dana\GF18534-PA 242 GF18534-PA 77..242 81..245 324 36.1 Plus
Dana\GF16481-PA 225 GF16481-PA 62..225 85..245 253 37.2 Plus
Dana\GF20636-PA 489 GF20636-PA 316..405 135..225 145 35.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:29:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11320-PA 244 GG11320-PA 1..244 1..245 1099 86.1 Plus
Dere\GG10246-PA 233 GG10246-PA 96..232 105..241 323 47.4 Plus
Dere\GG20410-PA 225 GG20410-PA 74..225 96..245 284 41.4 Plus
Dere\GG16942-PA 250 GG16942-PA 105..250 100..245 281 39.7 Plus
Dere\GG24711-PA 490 GG24711-PA 310..418 128..237 155 33.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:29:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19113-PA 219 GH19113-PA 7..216 27..242 681 63 Plus
Dgri\GH19482-PA 216 GH19482-PA 6..214 22..243 305 31.1 Plus
Dgri\GH18212-PA 234 GH18212-PA 19..234 23..245 263 29.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:36:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG6980-PA 250 CG6980-PA 1..250 1..250 1283 100 Plus
CG34297-PA 233 CG34297-PA 6..233 22..242 353 34.3 Plus
CG34274-PA 250 CG34274-PA 64..248 59..243 308 35.1 Plus
CG31294-PA 225 CG31294-PA 38..224 52..244 288 35.4 Plus
Stip1-PA 490 CG2720-PA 264..418 93..237 175 30.8 Plus
unc-45-PB 947 CG2708-PB 12..103 127..219 154 39.6 Plus
unc-45-PA 947 CG2708-PA 12..103 127..219 154 39.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:29:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23567-PA 209 GI23567-PA 10..206 27..242 580 57.4 Plus
Dmoj\GI13995-PA 206 GI13995-PA 60..202 99..241 324 43.4 Plus
Dmoj\GI24720-PA 233 GI24720-PA 87..229 99..241 323 43.4 Plus
Dmoj\GI10166-PA 244 GI10166-PA 99..244 100..245 286 35.6 Plus
Dmoj\GI22588-PA 226 GI22588-PA 78..226 97..245 275 38.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:29:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13629-PA 226 GL13629-PA 7..225 27..244 764 68.8 Plus
Dper\GL22045-PA 232 GL22045-PA 95..231 105..241 317 47.4 Plus
Dper\GL12700-PA 246 GL12700-PA 36..246 22..245 290 31.3 Plus
Dper\GL11931-PA 225 GL11931-PA 75..225 97..245 212 33.1 Plus
Dper\GL25924-PA 531 GL25924-PA 309..417 128..237 160 33.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:29:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20001-PA 226 GA20001-PA 7..225 27..244 764 68.8 Plus
Dpse\GA27357-PA 232 GA27357-PA 95..231 105..241 317 47.4 Plus
Dpse\GA27592-PA 246 GA27592-PA 36..246 22..245 289 31.3 Plus
Dpse\GA16156-PA 225 GA16156-PA 78..225 100..245 212 33.8 Plus
Dpse\GA15447-PA 489 GA15447-PA 309..417 128..237 159 33.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:29:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26628-PA 245 GM26628-PA 1..244 1..244 1209 94.7 Plus
Dsec\GM10528-PA 239 GM10528-PA 102..238 105..241 322 46.7 Plus
Dsec\GM24250-PA 193 GM24250-PA 25..193 78..245 304 37.9 Plus
Dsec\GM25756-PA 218 GM25756-PA 74..218 96..245 235 36.8 Plus
Dsec\GM15022-PA 214 GM15022-PA 34..142 128..237 156 33.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:29:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21131-PA 245 GD21131-PA 1..244 1..244 1203 94.3 Plus
Dsim\GD19039-PA 248 GD19039-PA 84..248 82..245 300 38.8 Plus
Dsim\GD19523-PA 298 GD19523-PA 96..217 105..226 278 45.9 Plus
Dsim\GD20333-PA 225 GD20333-PA 74..225 96..245 274 40.1 Plus
Dsim\Hop-PA 490 GD23015-PA 310..418 128..237 155 33.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:29:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23542-PA 139 GJ23542-PA 1..135 107..241 512 71.1 Plus
Dvir\GJ23936-PA 219 GJ23936-PA 78..216 105..243 319 44.6 Plus
Dvir\GJ10868-PA 232 GJ10868-PA 84..231 96..243 285 36.5 Plus
Dvir\GJ10310-PA 229 GJ10310-PA 85..229 101..245 264 38.6 Plus
Dvir\GJ10309-PA 228 GJ10309-PA 17..228 23..245 222 31.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:29:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14108-PA 225 GK14108-PA 8..225 28..245 679 59.8 Plus
Dwil\GK10830-PA 229 GK10830-PA 6..227 22..241 332 35.7 Plus
Dwil\GK11411-PA 229 GK11411-PA 47..229 71..245 298 36.6 Plus
Dwil\GK11681-PA 232 GK11681-PA 44..232 59..245 251 33.9 Plus
Dwil\GK18373-PA 492 GK18373-PA 312..420 128..237 157 33.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:29:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23516-PA 244 GE23516-PA 1..244 1..245 1099 85.3 Plus
Dyak\GE25831-PA 131 GE25831-PA 2..131 113..242 290 44.6 Plus
Dyak\GE26363-PA 225 GE26363-PA 74..225 96..245 286 42.8 Plus
Dyak\GE24329-PA 250 GE24329-PA 105..250 100..245 281 39.7 Plus
Dyak\Hop-PA 490 GE16725-PA 310..418 128..237 153 32.7 Plus