Clone GH10306 Report

Search the DGRC for GH10306

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:103
Well:6
Vector:pOT2
Associated Gene/TranscriptCG5577-RA
Protein status:GH10306.pep: gold
Preliminary Size:1068
Sequenced Size:1018

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5577 2001-01-01 Release 2 assignment
CG5577 2002-03-20 Blastp of sequenced clone
CG5577 2003-01-01 Sim4 clustering to Release 3
CG5577 2008-04-29 Release 5.5 accounting
CG5577 2008-08-15 Release 5.9 accounting
CG5577 2008-12-18 5.12 accounting

Clone Sequence Records

GH10306.complete Sequence

1018 bp (1018 high quality bases) assembled on 2002-03-20

GenBank Submission: AY094696

> GH10306.complete
CGAAGCGGTCTACGAAGCAAAATGTCCAGAGGCGGTGCTATCGACTTGAC
CGGCCTATCCGAGGAGCAGGTGAGCGAGTGGCTCCAAAGTTTCGACACGG
TTCTCTGCGACGGCGACGGCACCATATGGCAGGATGACACGGCCATCGCT
GGTGCTCCGGATGTGGTGAATGCCCTGCAGGATCGATTTGACAAAAAAGT
TTACCTGATTACCAACAATGGCCTAAAGACGCGACAGGAGCTCTTTGAGC
GCTCCCAGCGCCTTGGCTTCCATTTACCCAGCGACCGACACATCATTTCG
CCCACGGCGGCCATCGCCGACTATCTGGTTGGGAGTCCGAAGTTCGACAG
GACCCGGCACAAGGTCTATGTGGTGGGCAATGCGGCCATTGCGCGGGAAT
TAAGGCAGCGCGGAATCGACAGCTACGGAGCCGGCGGAACAGATGAACTG
CCTCCGGGCGACAAATGGCCGGACTTTGTGACACGCGAGTTTGGGAACCC
AGAGGCGGCGAAGGACGTGGGTGCCGTGGTGGTCGGCTGGGATGAGTACT
TTAGCTACTGCAAGATGGCGCGCGCCTGTCACATCCTCTGCAGTAATCCC
GACGCCGCCTTTTTGGTCACCAACCGGGATGCCGTGCACAAGTATCCATC
CTTTTGTATCCCCGGCACTGGGGCCTTTGTGGCCGGAATCGAGGCATGTT
CGGAGCGTGAAGCCCTCGAGATGGGCAAGCCAAATCCATTGGTCCTTGAG
CCCTTTATCAAGGCCGAGGGACTACGTACCGAGCGAACGCTTATGATTGG
TGACTGCCTCAAAATAGATGTCGGTTTCGCCAGCAATTGTGGCATGCTAT
CGCTTCTGGTGGGCACGGGTCGTTACAATAATCTCTCGGATGTCCGGCTG
GAAAAAGACAGGCTGCCCCAGCCAGACTTTTATCTGCCCCGTCTGGGCGA
TCTGCTGAACATTTTGTGAGCCATAAATCCATGGGACTCTCGCGCAGCAA
AAAAAAAAAAAAAAAAAA

GH10306.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:19:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG5577.a 1913 CG5577.a 59..1058 1..1000 5000 100 Plus
CG5577-RA 1404 CG5577-RA 64..1063 1..1000 5000 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:01:48
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 17829646..17830334 806..118 3445 100 Minus
chr3L 24539361 chr3L 17829401..17829593 998..806 965 100 Minus
chr3L 24539361 chr3L 17830896..17831014 119..1 595 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:42:10 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:01:46
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 17840036..17840724 806..118 3445 100 Minus
3L 28110227 3L 17839789..17839983 1000..806 975 100 Minus
3L 28110227 3L 17841286..17841404 119..1 595 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:49:06
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 17833136..17833824 806..118 3445 100 Minus
3L 28103327 3L 17832889..17833083 1000..806 975 100 Minus
3L 28103327 3L 17834386..17834504 119..1 595 100 Minus
Blast to na_te.dros performed on 2019-03-15 17:01:46 has no hits.

GH10306.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:02:47 Download gff for GH10306.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 17829401..17829592 807..998 100 <- Minus
chr3L 17829646..17830333 119..806 100 <- Minus
chr3L 17830897..17831014 1..118 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:32:34 Download gff for GH10306.complete
Subject Subject Range Query Range Percent Splice Strand
CG5577-RA 1..948 22..969 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:24:58 Download gff for GH10306.complete
Subject Subject Range Query Range Percent Splice Strand
CG5577-RA 1..948 22..969 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:25:37 Download gff for GH10306.complete
Subject Subject Range Query Range Percent Splice Strand
CG5577-RA 1..948 22..969 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:00:36 Download gff for GH10306.complete
Subject Subject Range Query Range Percent Splice Strand
CG5577-RA 1..948 22..969 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:23:24 Download gff for GH10306.complete
Subject Subject Range Query Range Percent Splice Strand
CG5577-RA 1..948 22..969 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:51:36 Download gff for GH10306.complete
Subject Subject Range Query Range Percent Splice Strand
CG5577-RA 1..998 1..998 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:24:58 Download gff for GH10306.complete
Subject Subject Range Query Range Percent Splice Strand
CG5577-RA 1..998 1..998 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:25:37 Download gff for GH10306.complete
Subject Subject Range Query Range Percent Splice Strand
CG5577-RA 24..1021 1..998 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:00:36 Download gff for GH10306.complete
Subject Subject Range Query Range Percent Splice Strand
CG5577-RA 1..998 1..998 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:23:24 Download gff for GH10306.complete
Subject Subject Range Query Range Percent Splice Strand
CG5577-RA 24..1021 1..998 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:02:47 Download gff for GH10306.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17839791..17839982 807..998 100 <- Minus
3L 17840036..17840723 119..806 100 <- Minus
3L 17841287..17841404 1..118 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:02:47 Download gff for GH10306.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17839791..17839982 807..998 100 <- Minus
3L 17840036..17840723 119..806 100 <- Minus
3L 17841287..17841404 1..118 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:02:47 Download gff for GH10306.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17839791..17839982 807..998 100 <- Minus
3L 17840036..17840723 119..806 100 <- Minus
3L 17841287..17841404 1..118 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:25:37 Download gff for GH10306.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 17832891..17833082 807..998 100 <- Minus
arm_3L 17833136..17833823 119..806 100 <- Minus
arm_3L 17834387..17834504 1..118 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:33:42 Download gff for GH10306.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17833136..17833823 119..806 100 <- Minus
3L 17834387..17834504 1..118 100   Minus
3L 17832891..17833082 807..998 100 <- Minus

GH10306.hyp Sequence

Translation from 1 to 968

> GH10306.hyp
RSGLRSKMSRGGAIDLTGLSEEQVSEWLQSFDTVLCDGDGTIWQDDTAIA
GAPDVVNALQDRFDKKVYLITNNGLKTRQELFERSQRLGFHLPSDRHIIS
PTAAIADYLVGSPKFDRTRHKVYVVGNAAIARELRQRGIDSYGAGGTDEL
PPGDKWPDFVTREFGNPEAAKDVGAVVVGWDEYFSYCKMARACHILCSNP
DAAFLVTNRDAVHKYPSFCIPGTGAFVAGIEACSEREALEMGKPNPLVLE
PFIKAEGLRTERTLMIGDCLKIDVGFASNCGMLSLLVGTGRYNNLSDVRL
EKDRLPQPDFYLPRLGDLLNIL*

GH10306.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:52:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG5577-PB 315 CG5577-PB 1..315 8..322 1668 100 Plus
CG5577-PA 315 CG5577-PA 1..315 8..322 1668 100 Plus
CG5567-PA 330 CG5567-PA 16..319 8..319 494 38.1 Plus
CG32488-PB 307 CG32488-PB 8..306 15..322 410 35 Plus
CG32488-PA 307 CG32488-PA 8..306 15..322 410 35 Plus

GH10306.pep Sequence

Translation from 21 to 968

> GH10306.pep
MSRGGAIDLTGLSEEQVSEWLQSFDTVLCDGDGTIWQDDTAIAGAPDVVN
ALQDRFDKKVYLITNNGLKTRQELFERSQRLGFHLPSDRHIISPTAAIAD
YLVGSPKFDRTRHKVYVVGNAAIARELRQRGIDSYGAGGTDELPPGDKWP
DFVTREFGNPEAAKDVGAVVVGWDEYFSYCKMARACHILCSNPDAAFLVT
NRDAVHKYPSFCIPGTGAFVAGIEACSEREALEMGKPNPLVLEPFIKAEG
LRTERTLMIGDCLKIDVGFASNCGMLSLLVGTGRYNNLSDVRLEKDRLPQ
PDFYLPRLGDLLNIL*

GH10306.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:28:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25233-PA 315 GF25233-PA 1..315 1..315 1340 81.9 Plus
Dana\GF25232-PA 316 GF25232-PA 1..303 1..311 523 39.4 Plus
Dana\GF10231-PA 308 GF10231-PA 1..307 1..315 426 34.3 Plus
Dana\GF10230-PA 309 GF10230-PA 12..300 5..311 381 33.7 Plus
Dana\GF12617-PA 318 GF12617-PA 9..304 9..315 288 27.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:28:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15776-PA 315 GG15776-PA 1..315 1..315 1552 91.1 Plus
Dere\GG15774-PA 315 GG15774-PA 1..304 1..312 517 38.1 Plus
Dere\GG14490-PA 307 GG14490-PA 1..306 1..315 446 35.2 Plus
Dere\GG14489-PA 320 GG14489-PA 10..315 3..315 421 33.2 Plus
Dere\GG22174-PA 314 GG22174-PA 1..306 1..315 375 32.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:28:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14464-PA 314 GH14464-PA 1..311 1..312 1044 64.9 Plus
Dgri\GH14463-PA 316 GH14463-PA 1..304 1..312 549 41.1 Plus
Dgri\GH23184-PA 319 GH23184-PA 9..314 3..315 487 37.8 Plus
Dgri\GH14574-PA 319 GH14574-PA 9..314 3..315 487 37.8 Plus
Dgri\GH14576-PA 309 GH14576-PA 1..301 1..308 387 36.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:28:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG5577-PB 315 CG5577-PB 1..315 1..315 1668 100 Plus
CG5577-PA 315 CG5577-PA 1..315 1..315 1668 100 Plus
CG5567-PA 330 CG5567-PA 16..319 1..312 494 38.1 Plus
CG32488-PB 307 CG32488-PB 8..306 8..315 410 35 Plus
CG32488-PA 307 CG32488-PA 8..306 8..315 410 35 Plus
CG32487-PA 320 CG32487-PA 16..315 9..315 382 31.3 Plus
CG11291-PA 308 CG11291-PA 1..299 1..308 378 33.8 Plus
CG10352-PB 315 CG10352-PB 7..298 9..311 242 30.4 Plus
CG2680-PB 305 CG2680-PB 10..300 12..315 233 27.1 Plus
CG15739-PB 308 CG15739-PB 10..300 12..315 222 27.2 Plus
CG15739-PA 308 CG15739-PA 10..300 12..315 222 27.2 Plus
CG17294-PA 255 CG17294-PA 2..230 23..292 163 27.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:28:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13609-PA 310 GI13609-PA 1..310 1..315 1035 62.5 Plus
Dmoj\GI13608-PA 316 GI13608-PA 1..304 1..312 526 39 Plus
Dmoj\GI13899-PA 314 GI13899-PA 4..309 3..315 458 36.1 Plus
Dmoj\GI13900-PA 307 GI13900-PA 1..307 1..315 418 33.8 Plus
Dmoj\GI14731-PA 303 GI14731-PA 9..299 12..315 238 25.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:28:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22744-PA 297 GL22744-PA 15..297 31..315 1090 71.6 Plus
Dper\GL22743-PA 314 GL22743-PA 5..309 3..315 507 39.5 Plus
Dper\GL13742-PA 308 GL13742-PA 1..307 1..315 396 33.4 Plus
Dper\GL16692-PA 317 GL16692-PA 1..303 1..311 388 33.2 Plus
Dper\GL18198-PA 305 GL18198-PA 1..304 1..315 387 33.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:28:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18982-PA 313 GA18982-PA 1..313 1..315 1198 71.4 Plus
Dpse\GA18976-PA 314 GA18976-PA 5..309 3..315 507 39.5 Plus
Dpse\GA16942-PA 308 GA16942-PA 1..307 1..315 403 33.7 Plus
Dpse\GA24194-PA 336 GA24194-PA 9..307 9..315 358 34.9 Plus
Dpse\GA16941-PA 321 GA16941-PA 25..313 17..312 357 36.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:28:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24300-PA 315 GM24300-PA 1..315 1..315 1606 94.9 Plus
Dsec\GM24299-PA 315 GM24299-PA 1..304 1..312 523 38.4 Plus
Dsec\GM14093-PA 307 GM14093-PA 1..306 1..315 442 35.8 Plus
Dsec\GM14092-PA 320 GM14092-PA 15..315 8..315 406 32.5 Plus
Dsec\GM13116-PA 308 GM13116-PA 10..300 12..315 236 28.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:28:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12369-PA 315 GD12369-PA 1..315 1..315 1606 95.2 Plus
Dsim\GD12368-PA 315 GD12368-PA 1..304 1..312 523 38.4 Plus
Dsim\GD13365-PA 307 GD13365-PA 1..306 1..315 444 36.1 Plus
Dsim\GD13364-PA 320 GD13364-PA 15..315 8..315 405 32.2 Plus
Dsim\GD11653-PA 308 GD11653-PA 1..300 1..309 381 33.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:28:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13945-PA 310 GJ13945-PA 1..307 1..312 1060 63.8 Plus
Dvir\GJ13944-PA 316 GJ13944-PA 1..304 1..312 534 39.6 Plus
Dvir\GJ11756-PA 321 GJ11756-PA 11..316 3..315 463 36.5 Plus
Dvir\GJ11757-PA 308 GJ11757-PA 1..301 1..309 401 35.8 Plus
Dvir\GJ18537-PA 304 GJ18537-PA 9..299 12..315 244 25.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:28:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10443-PA 313 GK10443-PA 1..313 1..315 1146 68.3 Plus
Dwil\GK21181-PA 318 GK21181-PA 10..309 8..315 538 41.4 Plus
Dwil\GK16579-PA 323 GK16579-PA 11..318 3..315 449 34.6 Plus
Dwil\GK17623-PA 311 GK17623-PA 1..310 1..315 424 35.2 Plus
Dwil\GK20804-PA 298 GK20804-PA 1..278 1..292 370 31.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:28:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22110-PA 315 GE22110-PA 1..315 1..315 1571 93.3 Plus
Dyak\GE22109-PA 315 GE22109-PA 1..304 1..312 518 38.1 Plus
Dyak\GE21679-PA 307 GE21679-PA 1..306 1..315 427 34.9 Plus
Dyak\GE21678-PA 320 GE21678-PA 10..315 3..315 422 33.9 Plus
Dyak\GE14167-PA 311 GE14167-PA 1..306 1..315 403 33.6 Plus