Clone GH10365 Report

Search the DGRC for GH10365

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:103
Well:65
Vector:pOT2
Associated Gene/TranscriptJupiter-RB
Protein status:GH10365.pep: gold
Preliminary Size:994
Sequenced Size:889

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31363 2001-11-29 Blastp of sequenced clone
Jupiter 2008-04-29 Release 5.5 accounting
Jupiter 2008-08-15 Release 5.9 accounting
Jupiter 2008-12-18 5.12 accounting

Clone Sequence Records

GH10365.complete Sequence

889 bp (889 high quality bases) assembled on 2001-11-29

GenBank Submission: AY069089

> GH10365.complete
TTGCTACACCGATCAAAACCAAAGCGCTTGAAAACAAAATTGTATTCAAC
GAAATAAGTTGTGCATTTATAAATATCTATATATATATATATTTTTTACT
GCACACGCACGCACTATAAACGTTAAATCTCAAAATCGTGTCAAACCAAC
CAACCAACCAACCGACCAATCCACGAACAATAACCAATTGTGTCTGTTGA
ATCGTATCGCGTCAGTCTTCCGCAATATGAGCACAAGACCAGACACCAAA
GAAACATCCCCACGCGTATCCTTGTGTCCCCCAGAACCGGCTCGAACCGA
AACGCCAATTCCACCGGCTGACGACGCCCTATCCATTGATAACTCGTGCC
GAGATAGCGAAGTTGGAGACGTGCCGGCAGATAACAGCACAGTCACAAAG
TCCGATCAGGTGAACGAGGGCTGTCAAACTCGGCGAGACTCTGGAAATAA
TCCCGAACAGCCATACTCGCTGAACAAGATGGCAGGCGTGAGCAATGTAA
AGGAGCCCCTTGGGCTCTGTCCAAACGAGATTAAGGAGGAGCAGCAGGCG
TGCTCCAAACTCGATTCACGCAATCCGATCACGGGCCTCGGCCTCAACGG
AGATGGTGTTGGCGGCCTCAAGCCCAAGAAGCTAAAGATCCGAGAGGGCA
ACCCCGTCACAGGCGAGGGCTACAAGGTCGTAGCCAACGAGTATTCCCAG
CGCCAGGAGTCGTCCAATGGCGGCACTCCGGTGATCAACAAGAACCGCAT
TCCCCCAGGCGGCTACTCGTCGGGCCTGTGGTAATGACAGCCGGAATTGC
TCAGATCCCAGCACAAGCAATTGAGGAGCCGATGGCGGGACGAGACACTA
TAAGAAAAAAAAAAAACCAACAAAAAAAAAAAAAAAAAA

GH10365.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:55:59
Subject Length Description Subject Range Query Range Score Percent Strand
Jupiter.g 1752 Jupiter.g 18..905 1..888 4395 99.6 Plus
Jupiter-RB 1588 Jupiter-RB 18..905 1..888 4395 99.6 Plus
Jupiter.d 1978 Jupiter.d 619..1295 212..888 3340 99.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:02:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 7416992..7417402 644..234 2055 100 Minus
chr3R 27901430 chr3R 7417486..7417718 233..1 1165 100 Minus
chr3R 27901430 chr3R 7416572..7416800 871..643 1145 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:42:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:02:54
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11591501..11591911 644..234 2055 100 Minus
3R 32079331 3R 11591064..11591309 888..643 1185 98.8 Minus
3R 32079331 3R 11591995..11592227 233..1 1165 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:21:21
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 11332332..11332742 644..234 2055 100 Minus
3R 31820162 3R 11331895..11332140 888..643 1185 98.7 Minus
3R 31820162 3R 11332826..11333058 233..1 1165 100 Minus
Blast to na_te.dros performed on 2019-03-16 07:02:54 has no hits.

GH10365.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:04:01 Download gff for GH10365.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 7416589..7416798 645..854 100 <- Minus
chr3R 7416992..7417402 234..644 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:32:47 Download gff for GH10365.complete
Subject Subject Range Query Range Percent Splice Strand
Jupiter-RB 1..558 227..784 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:27:25 Download gff for GH10365.complete
Subject Subject Range Query Range Percent Splice Strand
Jupiter-RB 1..558 227..784 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:29:35 Download gff for GH10365.complete
Subject Subject Range Query Range Percent Splice Strand
Jupiter-RB 1..558 227..784 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:54:59 Download gff for GH10365.complete
Subject Subject Range Query Range Percent Splice Strand
Jupiter-RB 1..558 227..784 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:27:47 Download gff for GH10365.complete
Subject Subject Range Query Range Percent Splice Strand
Jupiter-RB 1..558 227..784 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:04:14 Download gff for GH10365.complete
Subject Subject Range Query Range Percent Splice Strand
Jupiter-RB 18..871 1..854 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:27:24 Download gff for GH10365.complete
Subject Subject Range Query Range Percent Splice Strand
Jupiter-RB 18..871 1..854 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:29:35 Download gff for GH10365.complete
Subject Subject Range Query Range Percent Splice Strand
Jupiter-RB 18..871 1..854 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:55:00 Download gff for GH10365.complete
Subject Subject Range Query Range Percent Splice Strand
Jupiter-RB 18..871 1..854 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:27:47 Download gff for GH10365.complete
Subject Subject Range Query Range Percent Splice Strand
Jupiter-RB 18..871 1..854 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:04:01 Download gff for GH10365.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11591098..11591307 645..854 100 <- Minus
3R 11591501..11591911 234..644 100 <- Minus
3R 11591995..11592227 1..233 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:04:01 Download gff for GH10365.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11591098..11591307 645..854 100 <- Minus
3R 11591501..11591911 234..644 100 <- Minus
3R 11591995..11592227 1..233 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:04:01 Download gff for GH10365.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11591098..11591307 645..854 100 <- Minus
3R 11591501..11591911 234..644 100 <- Minus
3R 11591995..11592227 1..233 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:29:35 Download gff for GH10365.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7416820..7417029 645..854 100 <- Minus
arm_3R 7417223..7417633 234..644 100 <- Minus
arm_3R 7417717..7417949 1..233 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:31:01 Download gff for GH10365.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11331929..11332138 645..854 100 <- Minus
3R 11332332..11332742 234..644 100 <- Minus
3R 11332826..11333058 1..233 100   Minus

GH10365.hyp Sequence

Translation from 226 to 783

> GH10365.hyp
MSTRPDTKETSPRVSLCPPEPARTETPIPPADDALSIDNSCRDSEVGDVP
ADNSTVTKSDQVNEGCQTRRDSGNNPEQPYSLNKMAGVSNVKEPLGLCPN
EIKEEQQACSKLDSRNPITGLGLNGDGVGGLKPKKLKIREGNPVTGEGYK
VVANEYSQRQESSNGGTPVINKNRIPPGGYSSGLW*

GH10365.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:53:28
Subject Length Description Subject Range Query Range Score Percent Strand
Jupiter-PB 185 CG31363-PB 1..185 1..185 987 100 Plus
Jupiter-PI 105 CG31363-PI 52..105 132..185 255 88.9 Plus
Jupiter-PD 191 CG31363-PD 146..191 140..185 250 100 Plus
Jupiter-PC 197 CG31363-PC 152..197 140..185 250 100 Plus
Jupiter-PH 202 CG31363-PH 157..202 140..185 250 100 Plus

GH10365.pep Sequence

Translation from 226 to 783

> GH10365.pep
MSTRPDTKETSPRVSLCPPEPARTETPIPPADDALSIDNSCRDSEVGDVP
ADNSTVTKSDQVNEGCQTRRDSGNNPEQPYSLNKMAGVSNVKEPLGLCPN
EIKEEQQACSKLDSRNPITGLGLNGDGVGGLKPKKLKIREGNPVTGEGYK
VVANEYSQRQESSNGGTPVINKNRIPPGGYSSGLW*

GH10365.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 10:23:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16635-PA 354 GF16635-PA 203..354 33..185 536 66.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 10:23:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17211-PA 345 GG17211-PA 162..345 1..185 807 84.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 10:23:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12623-PA 227 GH12623-PA 89..227 44..185 254 42.2 Plus
Dgri\GH17288-PA 207 GH17288-PA 162..207 140..185 172 69.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:07:08
Subject Length Description Subject Range Query Range Score Percent Strand
Jupiter-PB 185 CG31363-PB 1..185 1..185 987 100 Plus
Jupiter-PI 105 CG31363-PI 52..105 132..185 255 88.9 Plus
Jupiter-PD 191 CG31363-PD 146..191 140..185 250 100 Plus
Jupiter-PC 197 CG31363-PC 152..197 140..185 250 100 Plus
Jupiter-PH 202 CG31363-PH 157..202 140..185 250 100 Plus
Jupiter-PE 208 CG31363-PE 163..208 140..185 250 100 Plus
Jupiter-PA 197 CG31363-PA 152..197 140..185 246 97.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 10:23:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11035-PA 190 GI11035-PA 6..190 5..185 401 47.6 Plus
Dmoj\GI11848-PA 78 GI11848-PA 19..56 112..149 157 84.2 Plus
Dmoj\GI23754-PA 203 GI23754-PA 159..203 140..185 157 69.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 10:23:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12395-PA 361 GL12395-PA 172..361 1..185 461 53.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:23:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22255-PA 193 GA22255-PA 35..193 33..185 453 58 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 10:23:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26090-PA 315 GM26090-PA 152..315 20..185 813 92.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 10:23:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15110-PA 183 GD15110-PA 1..183 1..185 881 91.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 10:23:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15816-PA 195 GJ15816-PA 32..195 30..185 417 54.1 Plus
Dvir\GJ13546-PA 84 GJ13546-PA 28..64 114..150 160 86.5 Plus
Dvir\GJ10600-PA 205 GJ10600-PA 162..205 140..185 155 69.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 10:23:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11035-PA 368 GK11035-PA 205..368 27..185 410 53.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 10:23:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10105-PA 347 GE10105-PA 162..347 1..185 801 83.4 Plus