Clone GH10427 Report

Search the DGRC for GH10427

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:104
Well:27
Vector:pOT2
Associated Gene/Transcriptsel-RA
Protein status:GH10427.pep: gold
Preliminary Size:1076
Sequenced Size:996

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12918 2001-01-01 Release 2 assignment
CG12918 2002-03-20 Blastp of sequenced clone
CG12918 2003-01-01 Sim4 clustering to Release 3
CG12918 2008-04-29 Release 5.5 accounting
CG12918 2008-08-15 Release 5.9 accounting
CG12918 2008-12-18 5.12 accounting

Clone Sequence Records

GH10427.complete Sequence

996 bp (996 high quality bases) assembled on 2002-03-20

GenBank Submission: AY094698

> GH10427.complete
CACAATTCTTGTGAACGCTGACCCAGACCCACTGACCGCGTCCCTCGTCA
CCACATCTTGGGCATAAATTAAGTAGAATTCTTCACTTATCGCTGCAGAG
CATCAAGAACCACGTCGCTCTTAAGTCGTCGTAAATACAGCACACGTCTT
TATCAACGCCGCACTTTTAAACGGAAGGCGCTTCTGCTGACGTGGTTAAT
GCAATTAGTTTCCACGCGTTAAACTATTAAACAATCAATTAAAAAGATGC
TGACGAAGGCGCTTATCCTGTTCGGCCTGCTGGCCTTGGCCCAAGGTTAC
AGCTTCACCTCCCGCGAGGTCAAGTGTCACGTGTGCAAGGCCGTGGTTAC
GGAACTGGAGGAGGCCATTGCCAAGGAGGACCCCCACAAGATGGCCGATG
TCAGTGGATTCCGGCTGGACGCACAGGGAAATTCGATCAGCAAGAAAGTT
CGCCTAGTGAAATCTGAAATGTTCCTTACCGAACTGATGGAGAAGATCTG
CGAAAAAATGGACGACTACTTGAAGGCAACCTACAAGAGCAACGGGAAAT
TCACACTCCTCAAGATGATCATCAATGGTCAGATGAACCCAGACTCCTCG
TTGGTTGACTTTGTGCAAGATGGTGATCTCAACAAAAGCCTGGGGCACTT
CTGCAACGAAGTACTGGAGGACAACGATGAGATCTTCGTTAAAGCCTTCC
AGGCCGAAGAGCTCGGAAACGATTTAGACATCAAGATCTGCTCAGAACAA
GCGAGCTACTGCGACGAATCGCCGGTCCAGGAGGAGTATGACTTTGATGG
CAAAGAGGAACTGTAGTTTGTCCCAGTGAAAGCTTAGTTAATTAACGAAT
TTCCTTGATCGCCGCCAGTGGAGGTCTTTGTACTGATATTTCGAACGAAA
ATTATGTTTAGCTAATGTAAAGAAAACCATGCCAAGTGTTACAAATTATG
TACGACAATAAATTCCATGTGCAATGTAAAAAAAAAAAAAAAAAAA

GH10427.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:19:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG12918-RA 1204 CG12918-RA 227..1204 1..978 4890 100 Plus
CG2249-RA 1346 CG2249-RA 1298..1346 978..930 245 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:20:11
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 5938400..5938877 977..500 2375 99.8 Minus
chr2R 21145070 chr2R 5939340..5939670 331..1 1655 100 Minus
chr2R 21145070 chr2R 5939071..5939240 500..331 850 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:42:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:20:09
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10050861..10051339 978..500 2395 100 Minus
2R 25286936 2R 10051802..10052132 331..1 1655 100 Minus
2R 25286936 2R 10051533..10051702 500..331 850 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:49:07
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 10052060..10052538 978..500 2395 100 Minus
2R 25260384 2R 10053001..10053331 331..1 1655 100 Minus
2R 25260384 2R 10052732..10052901 500..331 850 100 Minus
Blast to na_te.dros performed on 2019-03-16 15:20:09 has no hits.

GH10427.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:21:09 Download gff for GH10427.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 5938400..5938877 500..977 99 <- Minus
chr2R 5939072..5939239 332..499 100 <- Minus
chr2R 5939340..5939670 1..331 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:32:51 Download gff for GH10427.complete
Subject Subject Range Query Range Percent Splice Strand
CG12918-RA 1..570 247..816 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:25:02 Download gff for GH10427.complete
Subject Subject Range Query Range Percent Splice Strand
CG12918-RA 1..570 247..816 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:43:15 Download gff for GH10427.complete
Subject Subject Range Query Range Percent Splice Strand
sel-RA 1..570 247..816 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:00:40 Download gff for GH10427.complete
Subject Subject Range Query Range Percent Splice Strand
CG12918-RA 1..570 247..816 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:44:31 Download gff for GH10427.complete
Subject Subject Range Query Range Percent Splice Strand
sel-RA 1..570 247..816 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:51:39 Download gff for GH10427.complete
Subject Subject Range Query Range Percent Splice Strand
CG12918-RA 1..977 1..977 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:25:02 Download gff for GH10427.complete
Subject Subject Range Query Range Percent Splice Strand
CG12918-RA 46..1022 1..977 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:43:15 Download gff for GH10427.complete
Subject Subject Range Query Range Percent Splice Strand
sel-RA 36..1012 1..977 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:00:40 Download gff for GH10427.complete
Subject Subject Range Query Range Percent Splice Strand
CG12918-RA 1..977 1..977 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:44:31 Download gff for GH10427.complete
Subject Subject Range Query Range Percent Splice Strand
sel-RA 36..1012 1..977 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:21:09 Download gff for GH10427.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10050862..10051339 500..977 100 <- Minus
2R 10051534..10051701 332..499 100 <- Minus
2R 10051802..10052132 1..331 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:21:09 Download gff for GH10427.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10050862..10051339 500..977 100 <- Minus
2R 10051534..10051701 332..499 100 <- Minus
2R 10051802..10052132 1..331 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:21:09 Download gff for GH10427.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10050862..10051339 500..977 100 <- Minus
2R 10051534..10051701 332..499 100 <- Minus
2R 10051802..10052132 1..331 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:43:15 Download gff for GH10427.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5938367..5938844 500..977 100 <- Minus
arm_2R 5939039..5939206 332..499 100 <- Minus
arm_2R 5939307..5939637 1..331 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:33:45 Download gff for GH10427.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10052061..10052538 500..977 100 <- Minus
2R 10052733..10052900 332..499 100 <- Minus
2R 10053001..10053331 1..331 100   Minus

GH10427.hyp Sequence

Translation from 246 to 815

> GH10427.hyp
MLTKALILFGLLALAQGYSFTSREVKCHVCKAVVTELEEAIAKEDPHKMA
DVSGFRLDAQGNSISKKVRLVKSEMFLTELMEKICEKMDDYLKATYKSNG
KFTLLKMIINGQMNPDSSLVDFVQDGDLNKSLGHFCNEVLEDNDEIFVKA
FQAEELGNDLDIKICSEQASYCDESPVQEEYDFDGKEEL*

GH10427.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:53:48
Subject Length Description Subject Range Query Range Score Percent Strand
sel-PA 189 CG12918-PA 1..189 1..189 971 100 Plus

GH10427.pep Sequence

Translation from 246 to 815

> GH10427.pep
MLTKALILFGLLALAQGYSFTSREVKCHVCKAVVTELEEAIAKEDPHKMA
DVSGFRLDAQGNSISKKVRLVKSEMFLTELMEKICEKMDDYLKATYKSNG
KFTLLKMIINGQMNPDSSLVDFVQDGDLNKSLGHFCNEVLEDNDEIFVKA
FQAEELGNDLDIKICSEQASYCDESPVQEEYDFDGKEEL*

GH10427.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:29:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12915-PA 189 GF12915-PA 1..189 1..189 866 90.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:29:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25238-PA 189 GG25238-PA 1..189 1..189 967 96.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:29:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20247-PA 190 GH20247-PA 10..190 11..189 800 84 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:02:34
Subject Length Description Subject Range Query Range Score Percent Strand
sel-PA 189 CG12918-PA 1..189 1..189 971 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:29:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19417-PA 227 GI19417-PA 55..227 17..189 800 85 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:29:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10560-PA 189 GL10560-PA 1..189 1..189 863 86.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:29:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11907-PA 189 GA11907-PA 1..189 1..189 863 86.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:29:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20558-PA 189 GM20558-PA 1..189 1..189 985 99.5 Plus
Dsec\GM18732-PA 253 GM18732-PA 67..253 3..189 947 95.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:29:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD26011-PA 189 GD26011-PA 1..189 1..189 990 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:29:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22481-PA 190 GJ22481-PA 10..190 11..189 811 85.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:29:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21362-PA 189 GK21362-PA 1..189 1..189 857 84.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:29:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21841-PA 189 GE21841-PA 1..189 1..189 984 98.9 Plus