BDGP Sequence Production Resources |
Search the DGRC for GH10451
Library: | GH |
Tissue Source: | Drosophila melanogaster head |
Created by: | Ling Hong |
Date Registered: | 1998-06-02 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 104 |
Well: | 51 |
Vector: | pOT2 |
Associated Gene/Transcript | Ms-RA |
Protein status: | GH10451.pep: gold |
Preliminary Size: | 1300 |
Sequenced Size: | 929 |
Gene | Date | Evidence |
---|---|---|
CG6440 | 2001-01-01 | Release 2 assignment |
CG6440 | 2002-01-03 | Blastp of sequenced clone |
CG6440 | 2003-01-01 | Sim4 clustering to Release 3 |
Dms | 2008-04-29 | Release 5.5 accounting |
Dms | 2008-08-15 | Release 5.9 accounting |
Dms | 2008-12-18 | 5.12 accounting |
929 bp (929 high quality bases) assembled on 2002-01-03
GenBank Submission: AY075325
> GH10451.complete TTCAACAAGTCCAGCAAACAGAGCAGCAGCTGAACCCCGGTGTTAACAAC TAACAAGTTTGTCCATTAACTTCTTTGTGGAAGCACCGATACCTCAAAGC CCTCATCAGCATGTCCTTCGCTCAGTTCTTTGTCGCCTGCTGCCTGGCCA TCGTCCTCCTGGCCGTGTCCAACACACGGGCCGCAGTTCAGGGTCCACCT CTATGCCAGTCTGGCATCGTCGAGGAGATGCCGCCGCACATCCGGAAGGT GTGCCAGGCCCTGGAGAACTCCGATCAACTGACGTCGGCGCTGAAGTCCT ACATCAACAACGAGGCATCCGCTTTGGTGGCCAACTCTGATGACCTGTTG AAGAACTACAACAAGCGAACGGATGTCGATCACGTCTTCCTGCGTTTCGG AAAACGTCGTTAAGGACATTTTTTTGCAAGGACATCCCGAACACCACTTG GTCCCGACATGAGACAACGACACTGGACCCTGACCACAAGCGGCGGAATC GTTTCTGTTCACCCAAAAAGCACAACACTATTTTGACGTCTTCAGCATAA TTATGTAAACGTAATCGATGGAAACTCAGAACTATACTCAATTGGAAGCT CTCTAGTTCATTAAATATCCAATGTCCAATGTTTCTATGCAACAAAAAAA AAATCGAATACATATTTGTAAATACTCAAAGACCCTCGAAATGTTCTGAA AGTTAAACCCTTGGTTTTGATTTAATTCGTACTCTTTATTTGCTGAGTGT TATAAAGAACTAATAATACGTATTTCAACGATGTTTAAATATCTCACACA TATTTCCCTAGCATGAAGCACTATTATTAAATAACCAACAAATGTTTTCA AATCCAAACACTATTTTCCGTTGTATACTTTAATAAAGACAAACTTTTCC TCTCAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 20166453..20167036 | 321..904 | 2920 | 100 | Plus |
chr3R | 27901430 | chr3R | 20166176..20166390 | 107..321 | 1045 | 99.1 | Plus |
chr3R | 27901430 | chr3R | 20164923..20165031 | 1..109 | 545 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 24343102..24343687 | 321..906 | 2930 | 100 | Plus |
3R | 32079331 | 3R | 24342825..24343039 | 107..321 | 1075 | 100 | Plus |
3R | 32079331 | 3R | 24341572..24341680 | 1..109 | 545 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 24083933..24084518 | 321..906 | 2930 | 100 | Plus |
3R | 31820162 | 3R | 24083656..24083870 | 107..321 | 1075 | 100 | Plus |
3R | 31820162 | 3R | 24082403..24082511 | 1..109 | 545 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
17.6 | 7439 | 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). | 5223..5270 | 795..842 | 141 | 77.1 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 20164923..20165031 | 1..109 | 100 | -> | Plus |
chr3R | 20166179..20166390 | 110..321 | 99 | -> | Plus |
chr3R | 20166454..20167036 | 322..904 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Dms-RA | 1..303 | 111..413 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Dms-RA | 1..303 | 111..413 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ms-RA | 1..303 | 111..413 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Dms-RA | 1..303 | 111..413 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ms-RA | 1..303 | 111..413 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Dms-RA | 20..923 | 1..904 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Dms-RA | 20..923 | 1..904 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ms-RA | 22..925 | 1..904 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Dms-RA | 20..923 | 1..904 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ms-RA | 22..925 | 1..904 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 24341572..24341680 | 1..109 | 100 | -> | Plus |
3R | 24342828..24343039 | 110..321 | 100 | -> | Plus |
3R | 24343103..24343685 | 322..904 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 24341572..24341680 | 1..109 | 100 | -> | Plus |
3R | 24342828..24343039 | 110..321 | 100 | -> | Plus |
3R | 24343103..24343685 | 322..904 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 24341572..24341680 | 1..109 | 100 | -> | Plus |
3R | 24342828..24343039 | 110..321 | 100 | -> | Plus |
3R | 24343103..24343685 | 322..904 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 20168550..20168761 | 110..321 | 100 | -> | Plus |
arm_3R | 20167294..20167402 | 1..109 | 100 | -> | Plus |
arm_3R | 20168825..20169407 | 322..904 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 24083659..24083870 | 110..321 | 100 | -> | Plus |
3R | 24083934..24084516 | 322..904 | 100 | Plus | |
3R | 24082403..24082511 | 1..109 | 100 | -> | Plus |
Translation from 110 to 412
> GH10451.hyp MSFAQFFVACCLAIVLLAVSNTRAAVQGPPLCQSGIVEEMPPHIRKVCQA LENSDQLTSALKSYINNEASALVANSDDLLKNYNKRTDVDHVFLRFGKRR *
Translation from 110 to 412
> GH10451.pep MSFAQFFVACCLAIVLLAVSNTRAAVQGPPLCQSGIVEEMPPHIRKVCQA LENSDQLTSALKSYINNEASALVANSDDLLKNYNKRTDVDHVFLRFGKRR *
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF20742-PA | 100 | GF20742-PA | 1..100 | 1..100 | 486 | 90 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG11282-PA | 100 | GG11282-PA | 1..100 | 1..100 | 524 | 99 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18813-PA | 101 | GH18813-PA | 1..101 | 1..100 | 410 | 80.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Ms-PB | 100 | CG6440-PB | 1..100 | 1..100 | 511 | 100 | Plus |
Ms-PC | 100 | CG6440-PC | 1..100 | 1..100 | 511 | 100 | Plus |
Ms-PA | 100 | CG6440-PA | 1..100 | 1..100 | 511 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI10071-PA | 99 | GI10071-PA | 1..99 | 1..100 | 368 | 74 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL21855-PA | 100 | GL21855-PA | 1..100 | 1..100 | 488 | 91 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA19595-PA | 100 | GA19595-PA | 1..100 | 1..100 | 488 | 91 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM26590-PA | 100 | GM26590-PA | 1..100 | 1..100 | 529 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD21092-PA | 100 | GD21092-PA | 1..100 | 1..100 | 529 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23807-PA | 101 | GJ23807-PA | 1..101 | 1..100 | 405 | 81.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK22333-PA | 103 | GK22333-PA | 3..103 | 2..100 | 417 | 80.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE23474-PA | 100 | GE23474-PA | 1..100 | 1..100 | 529 | 100 | Plus |