Clone GH10451 Report

Search the DGRC for GH10451

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:104
Well:51
Vector:pOT2
Associated Gene/TranscriptMs-RA
Protein status:GH10451.pep: gold
Preliminary Size:1300
Sequenced Size:929

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6440 2001-01-01 Release 2 assignment
CG6440 2002-01-03 Blastp of sequenced clone
CG6440 2003-01-01 Sim4 clustering to Release 3
Dms 2008-04-29 Release 5.5 accounting
Dms 2008-08-15 Release 5.9 accounting
Dms 2008-12-18 5.12 accounting

Clone Sequence Records

GH10451.complete Sequence

929 bp (929 high quality bases) assembled on 2002-01-03

GenBank Submission: AY075325

> GH10451.complete
TTCAACAAGTCCAGCAAACAGAGCAGCAGCTGAACCCCGGTGTTAACAAC
TAACAAGTTTGTCCATTAACTTCTTTGTGGAAGCACCGATACCTCAAAGC
CCTCATCAGCATGTCCTTCGCTCAGTTCTTTGTCGCCTGCTGCCTGGCCA
TCGTCCTCCTGGCCGTGTCCAACACACGGGCCGCAGTTCAGGGTCCACCT
CTATGCCAGTCTGGCATCGTCGAGGAGATGCCGCCGCACATCCGGAAGGT
GTGCCAGGCCCTGGAGAACTCCGATCAACTGACGTCGGCGCTGAAGTCCT
ACATCAACAACGAGGCATCCGCTTTGGTGGCCAACTCTGATGACCTGTTG
AAGAACTACAACAAGCGAACGGATGTCGATCACGTCTTCCTGCGTTTCGG
AAAACGTCGTTAAGGACATTTTTTTGCAAGGACATCCCGAACACCACTTG
GTCCCGACATGAGACAACGACACTGGACCCTGACCACAAGCGGCGGAATC
GTTTCTGTTCACCCAAAAAGCACAACACTATTTTGACGTCTTCAGCATAA
TTATGTAAACGTAATCGATGGAAACTCAGAACTATACTCAATTGGAAGCT
CTCTAGTTCATTAAATATCCAATGTCCAATGTTTCTATGCAACAAAAAAA
AAATCGAATACATATTTGTAAATACTCAAAGACCCTCGAAATGTTCTGAA
AGTTAAACCCTTGGTTTTGATTTAATTCGTACTCTTTATTTGCTGAGTGT
TATAAAGAACTAATAATACGTATTTCAACGATGTTTAAATATCTCACACA
TATTTCCCTAGCATGAAGCACTATTATTAAATAACCAACAAATGTTTTCA
AATCCAAACACTATTTTCCGTTGTATACTTTAATAAAGACAAACTTTTCC
TCTCAAAAAAAAAAAAAAAAAAAAAAAAA

GH10451.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:48:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dms-RA 1098 Dms-RA 59..964 1..906 4530 100 Plus
Dms.c 1582 Dms.c 678..1582 1..905 4525 100 Plus
Dms.b 1235 Dms.b 331..1235 1..905 4525 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:13:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 20166453..20167036 321..904 2920 100 Plus
chr3R 27901430 chr3R 20166176..20166390 107..321 1045 99.1 Plus
chr3R 27901430 chr3R 20164923..20165031 1..109 545 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:42:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:13:41
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24343102..24343687 321..906 2930 100 Plus
3R 32079331 3R 24342825..24343039 107..321 1075 100 Plus
3R 32079331 3R 24341572..24341680 1..109 545 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:08:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 24083933..24084518 321..906 2930 100 Plus
3R 31820162 3R 24083656..24083870 107..321 1075 100 Plus
3R 31820162 3R 24082403..24082511 1..109 545 100 Plus
Blast to na_te.dros performed 2019-03-16 07:13:42
Subject Length Description Subject Range Query Range Score Percent Strand
17.6 7439 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). 5223..5270 795..842 141 77.1 Plus

GH10451.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:14:49 Download gff for GH10451.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 20164923..20165031 1..109 100 -> Plus
chr3R 20166179..20166390 110..321 99 -> Plus
chr3R 20166454..20167036 322..904 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:32:54 Download gff for GH10451.complete
Subject Subject Range Query Range Percent Splice Strand
Dms-RA 1..303 111..413 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:43:10 Download gff for GH10451.complete
Subject Subject Range Query Range Percent Splice Strand
Dms-RA 1..303 111..413 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:30:20 Download gff for GH10451.complete
Subject Subject Range Query Range Percent Splice Strand
Ms-RA 1..303 111..413 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:22:14 Download gff for GH10451.complete
Subject Subject Range Query Range Percent Splice Strand
Dms-RA 1..303 111..413 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:29:23 Download gff for GH10451.complete
Subject Subject Range Query Range Percent Splice Strand
Ms-RA 1..303 111..413 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:50:36 Download gff for GH10451.complete
Subject Subject Range Query Range Percent Splice Strand
Dms-RA 20..923 1..904 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:43:10 Download gff for GH10451.complete
Subject Subject Range Query Range Percent Splice Strand
Dms-RA 20..923 1..904 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:30:20 Download gff for GH10451.complete
Subject Subject Range Query Range Percent Splice Strand
Ms-RA 22..925 1..904 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:22:14 Download gff for GH10451.complete
Subject Subject Range Query Range Percent Splice Strand
Dms-RA 20..923 1..904 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:29:23 Download gff for GH10451.complete
Subject Subject Range Query Range Percent Splice Strand
Ms-RA 22..925 1..904 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:14:49 Download gff for GH10451.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24341572..24341680 1..109 100 -> Plus
3R 24342828..24343039 110..321 100 -> Plus
3R 24343103..24343685 322..904 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:14:49 Download gff for GH10451.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24341572..24341680 1..109 100 -> Plus
3R 24342828..24343039 110..321 100 -> Plus
3R 24343103..24343685 322..904 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:14:49 Download gff for GH10451.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24341572..24341680 1..109 100 -> Plus
3R 24342828..24343039 110..321 100 -> Plus
3R 24343103..24343685 322..904 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:30:20 Download gff for GH10451.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20168550..20168761 110..321 100 -> Plus
arm_3R 20167294..20167402 1..109 100 -> Plus
arm_3R 20168825..20169407 322..904 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:56:50 Download gff for GH10451.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24083659..24083870 110..321 100 -> Plus
3R 24083934..24084516 322..904 100   Plus
3R 24082403..24082511 1..109 100 -> Plus

GH10451.hyp Sequence

Translation from 110 to 412

> GH10451.hyp
MSFAQFFVACCLAIVLLAVSNTRAAVQGPPLCQSGIVEEMPPHIRKVCQA
LENSDQLTSALKSYINNEASALVANSDDLLKNYNKRTDVDHVFLRFGKRR
*

GH10451.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:53:56
Subject Length Description Subject Range Query Range Score Percent Strand
Ms-PB 100 CG6440-PB 1..100 1..100 511 100 Plus
Ms-PC 100 CG6440-PC 1..100 1..100 511 100 Plus
Ms-PA 100 CG6440-PA 1..100 1..100 511 100 Plus

GH10451.pep Sequence

Translation from 110 to 412

> GH10451.pep
MSFAQFFVACCLAIVLLAVSNTRAAVQGPPLCQSGIVEEMPPHIRKVCQA
LENSDQLTSALKSYINNEASALVANSDDLLKNYNKRTDVDHVFLRFGKRR
*

GH10451.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:24:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20742-PA 100 GF20742-PA 1..100 1..100 486 90 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:24:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11282-PA 100 GG11282-PA 1..100 1..100 524 99 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:24:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18813-PA 101 GH18813-PA 1..101 1..100 410 80.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:04:51
Subject Length Description Subject Range Query Range Score Percent Strand
Ms-PB 100 CG6440-PB 1..100 1..100 511 100 Plus
Ms-PC 100 CG6440-PC 1..100 1..100 511 100 Plus
Ms-PA 100 CG6440-PA 1..100 1..100 511 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:24:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10071-PA 99 GI10071-PA 1..99 1..100 368 74 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:24:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21855-PA 100 GL21855-PA 1..100 1..100 488 91 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:24:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19595-PA 100 GA19595-PA 1..100 1..100 488 91 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:24:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26590-PA 100 GM26590-PA 1..100 1..100 529 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:24:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21092-PA 100 GD21092-PA 1..100 1..100 529 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:24:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23807-PA 101 GJ23807-PA 1..101 1..100 405 81.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:24:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22333-PA 103 GK22333-PA 3..103 2..100 417 80.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:24:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23474-PA 100 GE23474-PA 1..100 1..100 529 100 Plus