Clone GH10666 Report

Search the DGRC for GH10666

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:106
Well:66
Vector:pOT2
Associated Gene/TranscriptCG3698-RA
Protein status:GH10666.pep: gold
Preliminary Size:4363
Sequenced Size:1154

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3698 2001-01-01 Release 2 assignment
CG3698 2003-01-01 Sim4 clustering to Release 3
CG3698 2003-01-13 Blastp of sequenced clone
CG3698 2008-04-29 Release 5.5 accounting
CG3698 2008-08-15 Release 5.9 accounting
CG3698 2008-12-18 5.12 accounting

Clone Sequence Records

GH10666.complete Sequence

1154 bp (1154 high quality bases) assembled on 2003-01-13

GenBank Submission: BT003301

> GH10666.complete
ATAAGTTTAGAACATAAAGTCACTATGTCGGAATCAACCGATCCCCATTG
CGCCACCTCCAAGTCCAACCTGATCAAGGTGAACCACGTGGGGGTGACGG
CCAAGCTGCAGTCTCCCCTGAAGAAGATCTTCCCACGGCTGAACTCCTCC
AGCGATTCCGACGCATATCAGCACAGTCAGACGCAGTACAACATGTTCAA
GGATGTGGCGCACGGGGAAATGACCGCGTCCACGGATTCGGGGAGCTCAC
CACACACTCTGTACGAGATGCACGCTGAGCCGGGGAAGAGTCAGCTTAGC
CTGAGCAAGAGCAAGCCCCAAAGGATCGAGTTCCAGCGTTACTCCAAGCG
CCGTCCCCGTGTGCTCGTCCCAACGAGAACTGCGCCGAAAGTGAAGGGTC
GTGCCACAAAGTCCCACAAATCATCGCAGGCGCAGAAGCAGAAGCAGAAG
AGTGGCTTTCTAGCCCGTTTAGTGGAGTCGCTGGACAAGATGTGCAAGTG
CCAGCCGCAGAGCCGAAATTCCATCATCGACGATCTGCCGGAGCCACAGT
GGAATCGCAAGGAGGCCAACCGGCACACCTGCATCGGCATCTATCCCTTC
GAGCATGGCTGCGCCGACTATCTGAGCACCACGGACTCGCATCCGAAGAT
CAATGCTATTGTCCTGGCCGACCGCGCCACCACCTATGCCACCCACTTCT
GGGCGGAGCTCTTCGGACTGCTGCACATCGCCGTGGCCTTCGTGGTAGCC
TTCATTCTGCAGAGCTACCGATTTGTCCTCTACTCCCTGGTGAACACCCT
GATCGTTGGACTGCTCCACATGACCTCCGACTACTTGCTCAAGCCCCTCC
TGACCATGCTCTTCAACGGCTACCTGCAGCCACCACTGATTTTCCTATAC
AATGTACTGTGCTCCGCCAGGGACATCCTCGATCCGGTGGCCACCACCCT
GAACAACTTGATGAAACCGCTGGCCACGGTGGGCGGCAGTATACGATTGG
TGGACGTCAACTATCGCCAGGTCCATAAGCTGGCCAAAGAGGTTTGAGTT
TCGTTTCGTTTACGCTGTTAAATTGTTATTGTTCGTTTTCGAAGTGCTTT
TCTTGTTATATTAAAAATAAGTACGGACTTTATATAAAAAAAAAAAAAAA
AAAA

GH10666.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:28:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG3698-RA 1140 CG3698-RA 1..1138 1..1138 5690 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:12:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 20786262..20787396 1135..1 5675 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:42:56 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:12:05
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 20797238..20798375 1138..1 5690 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:04:54
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 20790338..20791475 1138..1 5690 100 Minus
Blast to na_te.dros performed on 2019-03-15 12:12:06 has no hits.

GH10666.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:12:58 Download gff for GH10666.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 20786262..20787396 1..1135 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:33:37 Download gff for GH10666.complete
Subject Subject Range Query Range Percent Splice Strand
CG3698-RA 1..1023 25..1047 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:59:01 Download gff for GH10666.complete
Subject Subject Range Query Range Percent Splice Strand
CG3698-RA 1..1023 25..1047 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:39:05 Download gff for GH10666.complete
Subject Subject Range Query Range Percent Splice Strand
CG3698-RA 1..1023 25..1047 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:49:43 Download gff for GH10666.complete
Subject Subject Range Query Range Percent Splice Strand
CG3698-RA 1..1023 25..1047 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:54:22 Download gff for GH10666.complete
Subject Subject Range Query Range Percent Splice Strand
CG3698-RA 1..1023 25..1047 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:15:45 Download gff for GH10666.complete
Subject Subject Range Query Range Percent Splice Strand
CG3698-RA 1..1135 1..1135 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:59:01 Download gff for GH10666.complete
Subject Subject Range Query Range Percent Splice Strand
CG3698-RA 1..1135 1..1135 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:39:05 Download gff for GH10666.complete
Subject Subject Range Query Range Percent Splice Strand
CG3698-RA 1..1135 1..1135 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:49:43 Download gff for GH10666.complete
Subject Subject Range Query Range Percent Splice Strand
CG3698-RA 1..1135 1..1135 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:54:22 Download gff for GH10666.complete
Subject Subject Range Query Range Percent Splice Strand
CG3698-RA 1..1135 1..1135 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:12:58 Download gff for GH10666.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20797241..20798375 1..1135 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:12:58 Download gff for GH10666.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20797241..20798375 1..1135 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:12:58 Download gff for GH10666.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20797241..20798375 1..1135 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:39:05 Download gff for GH10666.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 20790341..20791475 1..1135 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:21:17 Download gff for GH10666.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20790341..20791475 1..1135 100   Minus

GH10666.hyp Sequence

Translation from 1 to 1046

> GH10666.hyp
ISLEHKVTMSESTDPHCATSKSNLIKVNHVGVTAKLQSPLKKIFPRLNSS
SDSDAYQHSQTQYNMFKDVAHGEMTASTDSGSSPHTLYEMHAEPGKSQLS
LSKSKPQRIEFQRYSKRRPRVLVPTRTAPKVKGRATKSHKSSQAQKQKQK
SGFLARLVESLDKMCKCQPQSRNSIIDDLPEPQWNRKEANRHTCIGIYPF
EHGCADYLSTTDSHPKINAIVLADRATTYATHFWAELFGLLHIAVAFVVA
FILQSYRFVLYSLVNTLIVGLLHMTSDYLLKPLLTMLFNGYLQPPLIFLY
NVLCSARDILDPVATTLNNLMKPLATVGGSIRLVDVNYRQVHKLAKEV*

GH10666.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:57:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG3698-PA 340 CG3698-PA 1..340 9..348 1764 100 Plus

GH10666.pep Sequence

Translation from 24 to 1046

> GH10666.pep
MSESTDPHCATSKSNLIKVNHVGVTAKLQSPLKKIFPRLNSSSDSDAYQH
SQTQYNMFKDVAHGEMTASTDSGSSPHTLYEMHAEPGKSQLSLSKSKPQR
IEFQRYSKRRPRVLVPTRTAPKVKGRATKSHKSSQAQKQKQKSGFLARLV
ESLDKMCKCQPQSRNSIIDDLPEPQWNRKEANRHTCIGIYPFEHGCADYL
STTDSHPKINAIVLADRATTYATHFWAELFGLLHIAVAFVVAFILQSYRF
VLYSLVNTLIVGLLHMTSDYLLKPLLTMLFNGYLQPPLIFLYNVLCSARD
ILDPVATTLNNLMKPLATVGGSIRLVDVNYRQVHKLAKEV*

GH10666.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:36:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24110-PA 336 GF24110-PA 1..336 1..340 1390 74.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:36:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13282-PA 337 GG13282-PA 1..337 1..340 1628 89.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:36:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14783-PA 341 GH14783-PA 1..341 1..340 1160 64.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:02:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG3698-PA 340 CG3698-PA 1..340 1..340 1764 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:36:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11886-PA 348 GI11886-PA 1..348 1..340 1147 62 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:36:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12750-PA 337 GL12750-PA 1..337 1..340 1209 68.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:36:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17621-PA 337 GA17621-PA 1..337 1..340 1214 68.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:36:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22185-PA 338 GM22185-PA 1..338 1..340 1656 94.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:36:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12160-PA 284 GD12160-PA 1..284 57..340 1405 95.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:36:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13765-PA 354 GJ13765-PA 1..354 1..340 1103 61 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:36:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12348-PA 347 GK12348-PA 1..339 1..332 1115 62.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:36:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22380-PA 337 GE22380-PA 1..337 1..340 1634 89.7 Plus