Clone GH10767 Report

Search the DGRC for GH10767

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:107
Well:67
Vector:pOT2
Associated Gene/TranscriptLsd-1-RC
Protein status:GH10767.pep: gold
Preliminary Size:1539
Sequenced Size:1424

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10374 2001-01-01 Release 2 assignment
CG10374 2001-07-04 Blastp of sequenced clone
CG10374 2003-01-01 Sim4 clustering to Release 3
Lsd-1 2008-04-29 Release 5.5 accounting
Lsd-1 2008-08-15 Release 5.9 accounting
Lsd-1 2008-12-18 5.12 accounting

Clone Sequence Records

GH10767.complete Sequence

1424 bp assembled on 2006-11-09

GenBank Submission: AY051436

> GH10767.complete
AACAGTTCTCGCATCTCAACCGAATCTTCTCGAGAAATCCCAACACAAAT
GGCAACTGCAACCAGCGGCAGTGGACTCCATCTGGAGGCCATCGATCGCA
TCGGCTCCATTCCCCTTGTGGAATCCAGTGTGAAGCGGGTGGAGACCATC
TACGATAAGGTGAAGAACAACAATAGGCTATTCTCATGGTATTTTGAGAC
GGCGGAGGCCACCATTTCGGCCGCCTACGAAACCATCCAGCCGGCGGTCA
AGCTCTTCGAGCCATCCATTCAGCGCCTGGACAACGTGATGTGCAAAAGC
CTGGACATTCTGGAGCAGCGCATACCACTGGTCTATCTGCCGCCCGAAAT
GATGTACTGGAACACCAAGGAGTACATGTCCGATCACCTGGTGCGTCCGG
TTCTGAAACGCGCCGATTCTGTCAAGCAAATCGGTAATGCTGTCCTCGAG
AGTCCACTTACCACTTATGCAGCCGAGCGCATTGATGGCGCTTTCACAGT
CGGCGATAAGTTCGTGGACAAGTACCTGGTGCCCATCCAAACAGATCAGG
ATCAGACCGATGGCCCACAGGAGGATGATAACGAGGCCGTGCCGGACGAG
AGGGGCGCCATCAAGGCGATCCATCATGGTCAACGCTTCTCCCGCAAACT
GAAGCGCCGCCTTACCCAAAGAACCATCGCAGAGGCTCGCGCCCTCAAAA
AGCAGAGCAAGGAGGCGATCCACGTGCTCTTCTATGCCGCAGAATTGATT
GCCACCGATCCCAAGCAGGCCGTTCAAAAGGCCAAGGAACTGTGGGTCTA
TCTCAGTGCAGATGAACCCGAAAATCAAGCGAGGCCCGCCACTCTGGAGC
AGTTGATTGTGCTACTGACCCGCGAATCGGCTAGGCGTGTGGTTCATCTA
GTGAACTTCAGTGCTCATGTGGCAGCCAACATACCCAGAAACCTGGCGCA
CACGACAACAGAGGTTGCCCACCATATTATCTATATCAACCACCGCATCA
TCACAATCTCACGGCTGGACAAGGTTAAAACCATCTCCAAAGAGGAAGCT
GAATCTCTTTTCAAGCGCATGCTGGCGTTCTATGGTAGCCTTCAGGGCCT
GACCAATGCCTACCTGGAGCGCGTGGCCAGCTTTCTATCCGGACGCATGG
AGGCCGAGAAGGTGACGGGCAGCGATGGCGGCAATTCCAACCACCGGTCA
TCGCGGAGGAGGCAGGATCCGAACCATTATTCAGCCACCCACAATAACAT
CAACGGCGTCTACTAGCATTGAATTCTTTATTGCTATCGTATTTTTATTT
CTGTTTCTCCGTGCATATACGGAAAATACACTAAACGATATTGTACATCT
ATTTTTAACATAATGCATTTGTCAATAATATAAGCCTAACTTCACGCTTA
ACAATAAAAAAAAAAAAAAAAAAA

GH10767.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:12:43
Subject Length Description Subject Range Query Range Score Percent Strand
Lsd-1-RC 1894 Lsd-1-RC 421..1826 1..1406 7030 100 Plus
Lsd-1-RB 1576 Lsd-1-RB 154..1508 52..1406 6775 100 Plus
Lsd-1.b 1903 Lsd-1.b 780..1835 351..1406 5280 100 Plus
Lsd-1.b 1903 Lsd-1.b 409..759 1..351 1755 100 Plus
Lsd-1-RB 1576 Lsd-1-RB 34..85 1..52 260 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:03:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 19587789..19588088 52..351 1485 99.7 Plus
chr3R 27901430 chr3R 19589772..19590075 1116..1405 1275 95.4 Plus
chr3R 27901430 chr3R 19588152..19588364 351..563 1065 100 Plus
chr3R 27901430 chr3R 19589274..19589465 747..938 945 99.5 Plus
chr3R 27901430 chr3R 19588910..19589095 562..747 930 100 Plus
chr3R 27901430 chr3R 19589526..19589707 936..1117 910 100 Plus
chr3R 27901430 chr3R 19587669..19587720 1..52 245 98.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:43:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:03:09
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23764385..23764684 52..351 1500 100 Plus
3R 32079331 3R 23766373..23766663 1116..1406 1455 100 Plus
3R 32079331 3R 23764748..23764960 351..563 1065 100 Plus
3R 32079331 3R 23765875..23766066 747..938 960 100 Plus
3R 32079331 3R 23765511..23765696 562..747 930 100 Plus
3R 32079331 3R 23766127..23766308 936..1117 910 100 Plus
3R 32079331 3R 23764265..23764316 1..52 260 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:06:35
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 23505216..23505515 52..351 1500 100 Plus
3R 31820162 3R 23507204..23507494 1116..1406 1455 100 Plus
3R 31820162 3R 23505579..23505791 351..563 1065 100 Plus
3R 31820162 3R 23506706..23506897 747..938 960 100 Plus
3R 31820162 3R 23506342..23506527 562..747 930 100 Plus
3R 31820162 3R 23506958..23507139 936..1117 910 100 Plus
3R 31820162 3R 23505096..23505147 1..52 260 100 Plus
Blast to na_te.dros performed on 2019-03-16 08:03:10 has no hits.

GH10767.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:04:01 Download gff for GH10767.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 19587669..19587720 1..52 98 -> Plus
chr3R 19587790..19588088 53..351 99 -> Plus
chr3R 19588153..19588363 352..562 100 -> Plus
chr3R 19588911..19589095 563..747 100 -> Plus
chr3R 19589275..19589465 748..938 99 -> Plus
chr3R 19589529..19589706 939..1116 100 -> Plus
chr3R 19589773..19589954 1117..1298 100 -> Plus
chr3R 19589969..19590075 1299..1405 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:33:53 Download gff for GH10767.complete
Subject Subject Range Query Range Percent Splice Strand
Lsd-1-RC 1..1218 49..1266 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:20:16 Download gff for GH10767.complete
Subject Subject Range Query Range Percent Splice Strand
Lsd-1-RC 1..1218 49..1266 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:53:02 Download gff for GH10767.complete
Subject Subject Range Query Range Percent Splice Strand
Lsd-1-RC 1..1218 49..1266 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:37:09 Download gff for GH10767.complete
Subject Subject Range Query Range Percent Splice Strand
Lsd-1-RC 1..1218 49..1266 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:34:10 Download gff for GH10767.complete
Subject Subject Range Query Range Percent Splice Strand
Lsd-1-RC 1..1218 49..1266 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:48:32 Download gff for GH10767.complete
Subject Subject Range Query Range Percent Splice Strand
Lsd-1-RC 409..1813 1..1405 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:20:16 Download gff for GH10767.complete
Subject Subject Range Query Range Percent Splice Strand
Lsd-1-RC 409..1813 1..1405 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:53:02 Download gff for GH10767.complete
Subject Subject Range Query Range Percent Splice Strand
Lsd-1-RC 409..1813 1..1405 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:37:09 Download gff for GH10767.complete
Subject Subject Range Query Range Percent Splice Strand
Lsd-1-RC 409..1813 1..1405 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:34:10 Download gff for GH10767.complete
Subject Subject Range Query Range Percent Splice Strand
Lsd-1-RC 409..1813 1..1405 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:04:01 Download gff for GH10767.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23764265..23764316 1..52 100 -> Plus
3R 23764386..23764684 53..351 100 -> Plus
3R 23764749..23764959 352..562 100 -> Plus
3R 23765512..23765696 563..747 100 -> Plus
3R 23765876..23766066 748..938 100 -> Plus
3R 23766130..23766307 939..1116 100 -> Plus
3R 23766374..23766662 1117..1405 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:04:01 Download gff for GH10767.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23764265..23764316 1..52 100 -> Plus
3R 23764386..23764684 53..351 100 -> Plus
3R 23764749..23764959 352..562 100 -> Plus
3R 23765512..23765696 563..747 100 -> Plus
3R 23765876..23766066 748..938 100 -> Plus
3R 23766130..23766307 939..1116 100 -> Plus
3R 23766374..23766662 1117..1405 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:04:01 Download gff for GH10767.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23764265..23764316 1..52 100 -> Plus
3R 23764386..23764684 53..351 100 -> Plus
3R 23764749..23764959 352..562 100 -> Plus
3R 23765512..23765696 563..747 100 -> Plus
3R 23765876..23766066 748..938 100 -> Plus
3R 23766130..23766307 939..1116 100 -> Plus
3R 23766374..23766662 1117..1405 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:53:02 Download gff for GH10767.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19591852..19592029 939..1116 100 -> Plus
arm_3R 19592096..19592384 1117..1405 100   Plus
arm_3R 19589987..19590038 1..52 100 -> Plus
arm_3R 19590108..19590406 53..351 100 -> Plus
arm_3R 19590471..19590681 352..562 100 -> Plus
arm_3R 19591234..19591418 563..747 100 -> Plus
arm_3R 19591598..19591788 748..938 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:49:20 Download gff for GH10767.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23505096..23505147 1..52 100 -> Plus
3R 23506961..23507138 939..1116 100 -> Plus
3R 23506343..23506527 563..747 100 -> Plus
3R 23506707..23506897 748..938 100 -> Plus
3R 23505217..23505515 53..351 100 -> Plus
3R 23505580..23505790 352..562 100 -> Plus
3R 23507205..23507493 1117..1405 100   Plus

GH10767.hyp Sequence

Translation from 1 to 1265

> GH10767.hyp
NSSRISTESSREIPTQMATATSGSGLHLEAIDRIGSIPLVESSVKRVETI
YDKVKNNNRLFSWYFETAEATISAAYETIQPAVKLFEPSIQRLDNVMCKS
LDILEQRIPLVYLPPEMMYWNTKEYMSDHLVRPVLKRADSVKQIGNAVLE
SPLTTYAAERIDGAFTVGDKFVDKYLVPIQTDQDQTDGPQEDDNEAVPDE
RGAIKAIHHGQRFSRKLKRRLTQRTIAEARALKKQSKEAIHVLFYAAELI
ATDPKQAVQKAKELWVYLSADEPENQARPATLEQLIVLLTRESARRVVHL
VNFSAHVAANIPRNLAHTTTEVAHHIIYINHRIITISRLDKVKTISKEEA
ESLFKRMLAFYGSLQGLTNAYLERVASFLSGRMEAEKVTGSDGGNSNHRS
SRRRQDPNHYSATHNNINGVY*

GH10767.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:58:41
Subject Length Description Subject Range Query Range Score Percent Strand
Lsd-1-PD 405 CG10374-PD 1..405 17..421 2059 100 Plus
Lsd-1-PC 405 CG10374-PC 1..405 17..421 2059 100 Plus
Lsd-1-PA 431 CG10374-PA 1..431 17..421 2016 93.7 Plus
Lsd-1-PB 325 CG10374-PB 1..325 97..421 1660 100 Plus
Lsd-2-PB 335 CG9057-PB 36..251 27..234 205 25.4 Plus

GH10767.pep Sequence

Translation from 48 to 1265

> GH10767.pep
MATATSGSGLHLEAIDRIGSIPLVESSVKRVETIYDKVKNNNRLFSWYFE
TAEATISAAYETIQPAVKLFEPSIQRLDNVMCKSLDILEQRIPLVYLPPE
MMYWNTKEYMSDHLVRPVLKRADSVKQIGNAVLESPLTTYAAERIDGAFT
VGDKFVDKYLVPIQTDQDQTDGPQEDDNEAVPDERGAIKAIHHGQRFSRK
LKRRLTQRTIAEARALKKQSKEAIHVLFYAAELIATDPKQAVQKAKELWV
YLSADEPENQARPATLEQLIVLLTRESARRVVHLVNFSAHVAANIPRNLA
HTTTEVAHHIIYINHRIITISRLDKVKTISKEEAESLFKRMLAFYGSLQG
LTNAYLERVASFLSGRMEAEKVTGSDGGNSNHRSSRRRQDPNHYSATHNN
INGVY*

GH10767.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:09:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16261-PA 405 GF16261-PA 1..405 1..405 2010 91.6 Plus
Dana\GF21059-PA 368 GF21059-PA 37..281 11..235 193 25.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:09:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11228-PA 405 GG11228-PA 1..405 1..405 2107 97 Plus
Dere\GG19422-PA 330 GG19422-PA 36..280 11..235 192 25.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:09:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23614-PA 409 GH23614-PA 1..409 1..405 1864 85.8 Plus
Dgri\GH24314-PA 368 GH24314-PA 42..261 11..205 182 23.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:21:26
Subject Length Description Subject Range Query Range Score Percent Strand
Lsd-1-PD 405 CG10374-PD 1..405 1..405 2059 100 Plus
Lsd-1-PC 405 CG10374-PC 1..405 1..405 2059 100 Plus
Lsd-1-PA 431 CG10374-PA 1..431 1..405 2016 93.7 Plus
Lsd-1-PB 325 CG10374-PB 1..325 81..405 1660 100 Plus
Lsd-2-PB 335 CG9057-PB 36..251 11..218 205 25.4 Plus
Lsd-2-PA 352 CG9057-PA 36..268 11..218 196 23.9 Plus
Lsd-2-PF 335 CG9057-PF 36..215 11..176 184 24.9 Plus
Lsd-2-PE 335 CG9057-PE 36..215 11..176 184 24.9 Plus
Lsd-2-PD 318 CG9057-PD 36..208 11..169 182 25.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:09:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10367-PA 401 GI10367-PA 3..401 8..405 1773 84.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:09:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23261-PA 412 GL23261-PA 10..412 5..405 1881 87.1 Plus
Dper\GL15208-PA 360 GL15208-PA 43..287 11..235 187 25.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:09:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10284-PA 408 GA10284-PA 1..408 1..405 1894 87.5 Plus
Dpse\GA10284-PB 434 GA10284-PB 1..434 1..405 1857 82.3 Plus
Dpse\GA10284-PC 327 GA10284-PC 1..327 81..405 1553 88.7 Plus
Dpse\GA21508-PA 360 GA21508-PA 43..287 11..235 187 25.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:09:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26530-PA 405 GM26530-PA 1..405 1..405 2143 98.3 Plus
Dsec\GM12009-PA 336 GM12009-PA 36..280 11..235 192 25.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:09:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21037-PA 404 GD21037-PA 1..404 1..405 2139 98.8 Plus
Dsim\GD15823-PA 336 GD15823-PA 36..280 11..235 192 25.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:09:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22586-PA 403 GJ22586-PA 2..403 7..405 1787 86.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:09:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22418-PA 417 GK22418-PA 1..417 1..405 1786 82.3 Plus
Dwil\GK16346-PA 366 GK16346-PA 47..292 11..235 188 25.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:09:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10394-PA 405 GE10394-PA 1..405 1..405 2117 97.3 Plus
Dyak\GE16074-PA 330 GE16074-PA 36..280 11..235 193 25.5 Plus