BDGP Sequence Production Resources |
Search the DGRC for GH10833
Library: | GH |
Tissue Source: | Drosophila melanogaster head |
Created by: | Ling Hong |
Date Registered: | 1998-06-02 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 108 |
Well: | 33 |
Vector: | pOT2 |
Associated Gene/Transcript | CG5045-RA |
Protein status: | GH10833.pep: gold |
Preliminary Size: | 1300 |
Sequenced Size: | 1005 |
Gene | Date | Evidence |
---|---|---|
CG5045 | 2001-01-01 | Release 2 assignment |
CG5045 | 2002-06-07 | Blastp of sequenced clone |
CG5045 | 2003-01-01 | Sim4 clustering to Release 3 |
CG5045 | 2008-04-29 | Release 5.5 accounting |
CG5045 | 2008-08-15 | Release 5.9 accounting |
CG5045 | 2008-12-18 | 5.12 accounting |
1005 bp (1005 high quality bases) assembled on 2002-06-07
GenBank Submission: AY119497
> GH10833.complete CCAGTCGGAATTCAGTGTTTCTTTTCATTTGTGTCAGAAATGATTTAAAG TGTGTATTCTTAGCCTTAAGAACAGCTGTTTTGCATAACATTGCGAATCC GGTTGATTTGCGTCAAAACAAAACCAGGATCATGCTGAAAACCGCTGTTA GCCGCTTTTTACAAATTAGTTCAGTACAATGTGGCGGCCGGGCGAATTCT GTTCGCAACATCAACCTGATTCCCATGGTGGTCGAGCAAACTGGCCGCGG TGAGCGGGCCTACGACATATTCTCACGTCTGCTGAAGGAGCGTATAATTT GCCTTATGGGCAACATAACCGACGACATCAGTTCGACTGTGGTGGCTCAA CTGCTGTTCCTGCAATCGGAGAACGTCAACAAACCGATCCATCTGTACAT CAATTCGCCCGGCGGTGTTGTTACAGCGGGTTTGGCGATCTACGATACGA TGCAGTACGTCAAGCCACCCATTGCAACTTGGTGCGTTGGACAGGCCTGC TCGATGGGATCCCTCCTGCTCGCGGCCGGTGCTCCTGGCATGCGGTACTC CCTACCCAACGCGCGAATAATGATACATCAGCCCTCTGGTGGCGCACAAG GCCAAGCCACAGACATCCTAATACATGCTGAGGAAATTATCAAAATCAAG CGCCAGCTGACCAACATCTACGTGAAGCACGCCAAGAATACGTACGAGGA GATGTCCGGACGCATGGAGCGCGACCACTTCATGACCCCCGAGGAGGCAA AAGTGCTGGGCATCATTGACCACGTGCTTGAACATCCTCCAGAGACTGTT TCCGAAACGGGACCCGCGTCGGACGGCGGCGTCACCTCCGGCAAAGCCGT GCCCGAGGAGTGCGAGAAGAAGAGAAGCAAGCAGGCAGCCTAAATTTCCA CCTTCCTATAGACCAAAATTCAATCATAAGTTCGAAACAATTTGAATAAT TCAGTTTTCCACAGAATATACACTTTCCAAATACAAAAAAAAAAAAAAAA AAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG5045-RA | 1280 | CG5045-RA | 54..1038 | 1..985 | 4925 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 10355873..10356299 | 174..600 | 2135 | 100 | Plus |
chr2L | 23010047 | chr2L | 10356348..10356739 | 593..984 | 1915 | 99.2 | Plus |
chr2L | 23010047 | chr2L | 10355647..10355822 | 1..176 | 880 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 10357010..10357436 | 174..600 | 2135 | 100 | Plus |
2L | 23513712 | 2L | 10357485..10357877 | 593..985 | 1935 | 99.5 | Plus |
2L | 23513712 | 2L | 10356784..10356959 | 1..176 | 880 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 10357010..10357436 | 174..600 | 2135 | 100 | Plus |
2L | 23513712 | 2L | 10357485..10357877 | 593..985 | 1935 | 99.4 | Plus |
2L | 23513712 | 2L | 10356784..10356959 | 1..176 | 880 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 10355647..10355819 | 1..173 | 100 | -> | Plus |
chr2L | 10355873..10356298 | 174..599 | 100 | -> | Plus |
chr2L | 10356355..10356739 | 600..984 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5045-RA | 1..762 | 132..893 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5045-RA | 1..762 | 132..893 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5045-RA | 1..762 | 132..893 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5045-RA | 1..762 | 132..893 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5045-RA | 1..762 | 132..893 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5045-RA | 42..1025 | 1..984 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5045-RA | 42..1025 | 1..984 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5045-RA | 1..973 | 12..984 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5045-RA | 42..1025 | 1..984 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5045-RA | 1..973 | 12..984 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 10356784..10356956 | 1..173 | 100 | -> | Plus |
2L | 10357010..10357435 | 174..599 | 100 | -> | Plus |
2L | 10357492..10357876 | 600..984 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 10356784..10356956 | 1..173 | 100 | -> | Plus |
2L | 10357010..10357435 | 174..599 | 100 | -> | Plus |
2L | 10357492..10357876 | 600..984 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 10356784..10356956 | 1..173 | 100 | -> | Plus |
2L | 10357010..10357435 | 174..599 | 100 | -> | Plus |
2L | 10357492..10357876 | 600..984 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 10356784..10356956 | 1..173 | 100 | -> | Plus |
arm_2L | 10357010..10357435 | 174..599 | 100 | -> | Plus |
arm_2L | 10357492..10357876 | 600..984 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 10357010..10357435 | 174..599 | 100 | -> | Plus |
2L | 10357492..10357876 | 600..984 | 100 | Plus | |
2L | 10356784..10356956 | 1..173 | 100 | -> | Plus |
Translation from 2 to 892
> GH10833.hyp SRNSVFLFICVRNDLKCVFLALRTAVLHNIANPVDLRQNKTRIMLKTAVS RFLQISSVQCGGRANSVRNINLIPMVVEQTGRGERAYDIFSRLLKERIIC LMGNITDDISSTVVAQLLFLQSENVNKPIHLYINSPGGVVTAGLAIYDTM QYVKPPIATWCVGQACSMGSLLLAAGAPGMRYSLPNARIMIHQPSGGAQG QATDILIHAEEIIKIKRQLTNIYVKHAKNTYEEMSGRMERDHFMTPEEAK VLGIIDHVLEHPPETVSETGPASDGGVTSGKAVPEECEKKRSKQAA*
Translation from 131 to 892
> GH10833.pep MLKTAVSRFLQISSVQCGGRANSVRNINLIPMVVEQTGRGERAYDIFSRL LKERIICLMGNITDDISSTVVAQLLFLQSENVNKPIHLYINSPGGVVTAG LAIYDTMQYVKPPIATWCVGQACSMGSLLLAAGAPGMRYSLPNARIMIHQ PSGGAQGQATDILIHAEEIIKIKRQLTNIYVKHAKNTYEEMSGRMERDHF MTPEEAKVLGIIDHVLEHPPETVSETGPASDGGVTSGKAVPEECEKKRSK QAA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF15771-PA | 252 | GF15771-PA | 1..252 | 1..253 | 1227 | 90.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG10114-PA | 253 | GG10114-PA | 1..253 | 1..253 | 1315 | 97.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH13604-PA | 255 | GH13604-PA | 1..253 | 1..253 | 1132 | 85.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG5045-PB | 253 | CG5045-PB | 1..253 | 1..253 | 1297 | 100 | Plus |
CG5045-PA | 253 | CG5045-PA | 1..253 | 1..253 | 1297 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20379-PA | 223 | GI20379-PA | 1..223 | 32..253 | 1093 | 91.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL19149-PA | 253 | GL19149-PA | 1..253 | 1..253 | 1185 | 86.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA18618-PA | 253 | GA18618-PA | 1..253 | 1..253 | 1186 | 87 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM18225-PA | 253 | GM18225-PA | 1..253 | 1..253 | 1340 | 98.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23683-PA | 253 | GD23683-PA | 1..253 | 1..253 | 1336 | 98.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13731-PA | 254 | GJ13731-PA | 1..254 | 1..253 | 1151 | 85.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK15263-PA | 255 | GK15263-PA | 1..255 | 1..253 | 1170 | 85.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE18928-PA | 253 | GE18928-PA | 1..253 | 1..253 | 1329 | 97.6 | Plus |