Clone GH10864 Report

Search the DGRC for GH10864

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:108
Well:64
Vector:pOT2
Associated Gene/TranscriptTpi-RB
Protein status:GH10864.pep: gold
Preliminary Size:1300
Sequenced Size:1211

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2171 2001-01-01 Release 2 assignment
CG2171 2004-05-05 Blastp of sequenced clone
Tpi 2008-04-29 Release 5.5 accounting
Tpi 2008-08-15 Release 5.9 accounting
Tpi 2008-12-18 5.12 accounting

Clone Sequence Records

GH10864.complete Sequence

1211 bp (1211 high quality bases) assembled on 2004-05-05

GenBank Submission: BT014664

> GH10864.complete
TTAATCTCGAATCTGGGAAAAATCTGAGTGGAAAAGTCGACGGCGAGCCT
CCAGTCATCGAGTTACCCACTTGAAATTATCAGTTCCAAACACTCTAATA
GCAGTCCCCTTGTTTTGTCCCCCGATCCGCAGTTCTACGCCAATTTCAGC
ACCGATTGCACCGACAGCAACAGCAACAACATGAGCCGAAAGTTCTGCGT
GGGAGGCAACTGGAAGATGAACGGCGACCAGAAGTCCATCGCCGAGATCG
CCAAGACCCTGAGCTCGGCCGCCCTCGACCCCAACACGGAGGTGGTCATC
GGCTGCCCGGCCATCTACCTGATGTACGCCCGCAACCTGCTGCCCTGCGA
GCTGGGTCTGGCCGGCCAGAATGCCTACAAGGTGGCCAAGGGCGCATTCA
CCGGCGAGATCTCCCCTGCGATGCTGAAGGACATCGGCGCCGACTGGGTG
ATCCTGGGACACTCGGAGCGTCGCGCCATCTTCGGCGAATCGGACGCCCT
GATCGCCGAGAAGGCCGAGCACGCCCTGGCCGAGGGCCTCAAGGTCATCG
CCTGCATTGGTGAGACCCTGGAGGAGCGCGAGGCCGGCAAGACCAACGAG
GTGGTGGCCCGCCAAATGTGCGCCTACGCCCAGAAGATCAAGGACTGGAA
GAACGTGGTGGTGGCCTACGAGCCCGTCTGGGCCATTGGCACCGGCCAGA
CCGCCACACCCGATCAGGCTCAAGAGGTCCACGCCTTCCTGCGCCAGTGG
CTGAGCGACAACATCTCCAAGGAGGTGTCCGCCAGCCTGCGCATCCAGTA
CGGTGGATCCGTGACCGCCGCCAACGCCAAGGAGCTGGCCAAGAAGCCCG
ACATAGATGGCTTCCTGGTCGGAGGCGCCTCCCTGAAGCCCGAGTTCGTG
GACATCATCAACGCCCGGCAGTAAGCAACGCGATCTCAAGCATCAGATCG
CTTTCGGCCAGCGAACTGCCCGCGAAGGAGGCACTGGAGGGCAGGACTCC
ATACTCCTGCGCGCGAATGCATTACGCACACACCTAGTTGTTGTCACCAC
CAAGTGCAGTTCCAAATTCATAGTTACCTTGCGAGAATGCTACTCACATC
CTTGTTGTTGAACGTATAGTAGTCCATTGTGTAAATCTTAAATTATTCAG
GCAATAATTATGCGCTACTCATTTACTTATATACCAAAAAAAAAAAAAAA
AAAAAAAAAAA

GH10864.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:01:13
Subject Length Description Subject Range Query Range Score Percent Strand
Tpi-RC 1375 Tpi-RC 58..1245 1..1188 5940 100 Plus
Tpi-RB 1316 Tpi-RB 53..1110 131..1188 5290 100 Plus
Tpi.a 1597 Tpi.a 320..1377 131..1188 5290 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:30:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 25955932..25956649 718..1 3590 100 Minus
chr3R 27901430 chr3R 25955404..25955874 1185..715 2355 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:43:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:30:15
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30133509..30134226 718..1 3590 100 Minus
3R 32079331 3R 30132978..30133451 1188..715 2370 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:49:40
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29874340..29875057 718..1 3590 100 Minus
3R 31820162 3R 29873809..29874282 1188..715 2370 100 Minus
Blast to na_te.dros performed 2019-03-16 02:30:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2787..2868 147..228 140 63.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2288..2452 122..286 132 56 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6718..6839 143..264 124 55.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6764..6875 147..264 118 57.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2604..2655 135..186 116 69.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6806..6855 141..190 115 70 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6857..6897 141..181 115 75.6 Plus
roo 9092 roo DM_ROO 9092bp 1112..1152 141..181 115 75.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2364..2420 135..191 114 66.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6785..6875 135..225 113 58.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6743..6831 147..232 113 61.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2379..2528 135..287 110 56.4 Plus

GH10864.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:31:02 Download gff for GH10864.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 25955404..25955871 718..1185 100 <- Minus
chr3R 25955933..25956649 1..717 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:34:11 Download gff for GH10864.complete
Subject Subject Range Query Range Percent Splice Strand
Tpi-RA 254..1047 131..924 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:36:09 Download gff for GH10864.complete
Subject Subject Range Query Range Percent Splice Strand
Tpi-RA 254..1047 131..924 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:03:45 Download gff for GH10864.complete
Subject Subject Range Query Range Percent Splice Strand
Tpi-RA 254..1047 131..924 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:20:00 Download gff for GH10864.complete
Subject Subject Range Query Range Percent Splice Strand
Tpi-RA 254..1047 131..924 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:13:21 Download gff for GH10864.complete
Subject Subject Range Query Range Percent Splice Strand
Tpi-RA 254..1047 131..924 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:43:10 Download gff for GH10864.complete
Subject Subject Range Query Range Percent Splice Strand
Tpi-RC 50..1234 1..1185 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:36:09 Download gff for GH10864.complete
Subject Subject Range Query Range Percent Splice Strand
Tpi-RC 50..1234 1..1185 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:03:45 Download gff for GH10864.complete
Subject Subject Range Query Range Percent Splice Strand
Tpi-RC 84..1268 1..1185 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:20:00 Download gff for GH10864.complete
Subject Subject Range Query Range Percent Splice Strand
Tpi-RC 50..1234 1..1185 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:13:21 Download gff for GH10864.complete
Subject Subject Range Query Range Percent Splice Strand
Tpi-RC 84..1268 1..1185 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:31:02 Download gff for GH10864.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30132981..30133448 718..1185 100 <- Minus
3R 30133510..30134226 1..717 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:31:02 Download gff for GH10864.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30132981..30133448 718..1185 100 <- Minus
3R 30133510..30134226 1..717 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:31:02 Download gff for GH10864.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30132981..30133448 718..1185 100 <- Minus
3R 30133510..30134226 1..717 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:03:45 Download gff for GH10864.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25958703..25959170 718..1185 100 <- Minus
arm_3R 25959232..25959948 1..717 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:57:16 Download gff for GH10864.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29873812..29874279 718..1185 100 <- Minus
3R 29874341..29875057 1..717 100   Minus

GH10864.hyp Sequence

Translation from 180 to 923

> GH10864.hyp
MSRKFCVGGNWKMNGDQKSIAEIAKTLSSAALDPNTEVVIGCPAIYLMYA
RNLLPCELGLAGQNAYKVAKGAFTGEISPAMLKDIGADWVILGHSERRAI
FGESDALIAEKAEHALAEGLKVIACIGETLEEREAGKTNEVVARQMCAYA
QKIKDWKNVVVAYEPVWAIGTGQTATPDQAQEVHAFLRQWLSDNISKEVS
ASLRIQYGGSVTAANAKELAKKPDIDGFLVGGASLKPEFVDIINARQ*

GH10864.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:59:50
Subject Length Description Subject Range Query Range Score Percent Strand
Tpi-PC 247 CG2171-PC 1..247 1..247 1268 100 Plus
Tpi-PB 247 CG2171-PB 1..247 1..247 1268 100 Plus
Tpi-PA 348 CG2171-PA 102..348 1..247 1268 100 Plus

GH10864.pep Sequence

Translation from 180 to 923

> GH10864.pep
MSRKFCVGGNWKMNGDQKSIAEIAKTLSSAALDPNTEVVIGCPAIYLMYA
RNLLPCELGLAGQNAYKVAKGAFTGEISPAMLKDIGADWVILGHSERRAI
FGESDALIAEKAEHALAEGLKVIACIGETLEEREAGKTNEVVARQMCAYA
QKIKDWKNVVVAYEPVWAIGTGQTATPDQAQEVHAFLRQWLSDNISKEVS
ASLRIQYGGSVTAANAKELAKKPDIDGFLVGGASLKPEFVDIINARQ*

GH10864.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:14:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16201-PA 309 GF16201-PA 65..309 3..247 1233 94.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:14:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11962-PA 348 GG11962-PA 102..348 1..247 1300 98.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:14:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18391-PA 306 GH18391-PA 61..306 2..247 1144 86.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:09:49
Subject Length Description Subject Range Query Range Score Percent Strand
Tpi-PC 247 CG2171-PC 1..247 1..247 1268 100 Plus
Tpi-PB 247 CG2171-PB 1..247 1..247 1268 100 Plus
Tpi-PA 348 CG2171-PA 102..348 1..247 1268 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:14:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23383-PA 307 GI23383-PA 63..307 3..247 1208 90.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:14:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14069-PA 299 GL14069-PA 54..299 2..247 1234 92.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:14:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Tpi-PA 299 GA15281-PA 54..299 2..247 1234 92.7 Plus
Dpse\Tpi-PC 248 GA15281-PC 3..248 2..247 1228 92.7 Plus
Dpse\Tpi-PB 248 GA15281-PB 3..248 2..247 1228 92.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:14:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12179-PA 348 GM12179-PA 102..348 1..247 1302 99.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:14:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Tpi-PA 348 GD17322-PA 102..348 1..247 1302 99.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:14:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10377-PA 307 GJ10377-PA 62..307 2..247 1192 89 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:14:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13151-PA 308 GK13151-PA 64..308 3..247 1205 90.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:14:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Tpi-PA 350 GE23412-PA 104..350 1..247 1303 99.2 Plus