BDGP Sequence Production Resources |
Search the DGRC for GH10911
Library: | GH |
Tissue Source: | Drosophila melanogaster head |
Created by: | Ling Hong |
Date Registered: | 1998-06-02 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 109 |
Well: | 11 |
Vector: | pOT2 |
Associated Gene/Transcript | mri-RC |
Protein status: | GH10911.pep: wuzgold |
Preliminary Size: | 995 |
Sequenced Size: | 924 |
Gene | Date | Evidence |
---|---|---|
CG1216 | 2001-01-01 | Release 2 assignment |
CG1216 | 2002-03-20 | Blastp of sequenced clone |
CG1216 | 2003-01-01 | Sim4 clustering to Release 3 |
mri | 2008-04-29 | Release 5.5 accounting |
mri | 2008-08-15 | Release 5.9 accounting |
mri | 2008-12-18 | 5.12 accounting |
924 bp (924 high quality bases) assembled on 2002-03-20
GenBank Submission: AY094703
> GH10911.complete TTTTCCGTCTCTTTCCTTGTAACATGCCCTCTGTTATGTTTGACATAAAG GAGGCCTTCTCCACGAGCTTAGCAACGAAGGAGCGCGACAACAATTTGAA CTCTTTCTTGAGGACCTAATTCTGCCCCTCATGGTGGCCTCGGCGCAGCG CGGGGATCGAGAGTGTCACGTTGTGGTGCTCCTTGAAGACGATATGGTCG AGTGGGATGAAGAGTTTCCGCCTCAGATGGGCGAGGAGTATTGTCAGACC GTGCACAGCACTGCCATGCACCGATTCTTCAAGTACATCGAGAACCGCGA TGTGGCCAAACAGGTGATGAAGGATCGCGGTCTGAAGAAGATACGCTGTG GCATAGAGGGATACCCCACCCACAAAGAGAAGATCCGAAGGCGTCCCGGT GGACGGGCTGAAGTCATCTACAGCTATGTGCAGCGACCTTTCATCCACAT GTCCTGGGAGAAGGAGGAAGCAAAGAGTCGCCATGTTGATTTCCAATGTG TAAAATCCAAGTCTGTAACGAATCTAGCGGAAGCAAATGCAGATCCGCCA CTGGAATTGGACGCAAGTGGAAATCCGATTCCCCCTATAGCAGTGGCTAA TCCGCATCCCAATAACGCTGAGCTCGCTGCCGGTATGGCCGTCGCACCCG CAGCTATAGGCGTGGCTGGTCCAGCAGTCGTGGTAGCCGTCGACGAGGCG GCCGGGGGCGTTGTAATGCTCAACGAGTTGGACCAGGCAGCGATCGCTGT TGCCGTCGGAATAGTTGATGAAAATATGTAGATCAACTGACCGGCTGGTA GTCGGAACACACTGCCAGAGCATCACAGCGCACAGAAAAACACTTTACGT TTTTAATTAACATTTTTATATGTATATGTAATAAATGGAAATTTCGAATA CGAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 201772..202107 | 567..902 | 1680 | 100 | Plus |
chr3L | 24539361 | chr3L | 201396..201716 | 249..569 | 1605 | 100 | Plus |
chr3L | 24539361 | chr3L | 201076..201323 | 1..248 | 1240 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
gypsy11 | 4428 | gypsy11 GYPSY11 4428bp | 1208..1253 | 887..842 | 113 | 71.7 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 201396..201713 | 249..566 | 100 | -> | Plus |
chr3L | 201076..201323 | 1..248 | 100 | -> | Plus |
chr3L | 201772..202107 | 567..902 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mri-RA | 584..1320 | 43..781 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mri-RA | 584..1320 | 43..781 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mri-RB | 584..1320 | 43..781 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mri-RA | 584..1320 | 43..781 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mri-RB | 584..1320 | 43..781 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mri-RC | 1..902 | 1..902 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mri-RC | 1..902 | 1..902 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mri-RB | 790..1647 | 43..902 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mri-RC | 1..902 | 1..902 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mri-RB | 790..1647 | 43..902 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 201817..202152 | 567..902 | 100 | Plus | |
3L | 201121..201368 | 1..248 | 100 | -> | Plus |
3L | 201441..201758 | 249..566 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 201817..202152 | 567..902 | 100 | Plus | |
3L | 201121..201368 | 1..248 | 100 | -> | Plus |
3L | 201441..201758 | 249..566 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 201817..202152 | 567..902 | 100 | Plus | |
3L | 201121..201368 | 1..248 | 100 | -> | Plus |
3L | 201441..201758 | 249..566 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 201121..201368 | 1..248 | 100 | -> | Plus |
arm_3L | 201441..201758 | 249..566 | 100 | -> | Plus |
arm_3L | 201817..202152 | 567..902 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 201121..201368 | 1..248 | 100 | -> | Plus |
3L | 201441..201758 | 249..566 | 100 | -> | Plus |
3L | 201817..202152 | 567..902 | 100 | Plus |
Translation from 130 to 780
> GH10911.hyp MVASAQRGDRECHVVVLLEDDMVEWDEEFPPQMGEEYCQTVHSTAMHRFF KYIENRDVAKQVMKDRGLKKIRCGIEGYPTHKEKIRRRPGGRAEVIYSYV QRPFIHMSWEKEEAKSRHVDFQCVKSKSVTNLAEANADPPLELDASGNPI PPIAVANPHPNNAELAAGMAVAPAAIGVAGPAVVVAVDEAAGGVVMLNEL DQAAIAVAVGIVDENM*
Translation from 130 to 780
> GH10911.pep MVASAQRGDRECHVVVLLEDDMVEWDEEFPPQMGEEYCQTVHSTAMHRFF KYIENRDVAKQVMKDRGLKKIRCGIEGYPTHKEKIRRRPGGRAEVIYSYV QRPFIHMSWEKEEAKSRHVDFQCVKSKSVTNLAEANADPPLELDASGNPI PPIAVANPHPNNAELAAGMAVAPAAIGVAGPAVVVAVDEAAGGVVMLNEL DQAAIAVAVGIVDENM*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23868-PA | 433 | GF23868-PA | 219..433 | 1..216 | 955 | 93.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG14698-PA | 439 | GG14698-PA | 224..439 | 1..216 | 1144 | 99.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15823-PA | 487 | GH15823-PA | 265..487 | 1..216 | 888 | 82.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mri-PE | 438 | CG1216-PE | 223..438 | 1..216 | 1126 | 100 | Plus |
mri-PA | 439 | CG1216-PA | 224..439 | 1..216 | 1126 | 100 | Plus |
mri-PB | 439 | CG1216-PB | 224..439 | 1..216 | 1126 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI12605-PA | 449 | GI12605-PA | 237..449 | 1..216 | 870 | 84.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL16111-PA | 455 | GL16111-PA | 248..455 | 1..216 | 934 | 89.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA28384-PA | 453 | GA28384-PA | 246..453 | 1..216 | 934 | 89.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM14314-PA | 379 | GM14314-PA | 224..362 | 1..139 | 769 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD13551-PA | 439 | GD13551-PA | 224..438 | 1..215 | 1136 | 99.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ12727-PA | 469 | GJ12727-PA | 250..469 | 1..216 | 885 | 84.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK17332-PA | 478 | GK17332-PA | 260..472 | 1..204 | 855 | 85 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE21061-PA | 439 | GE21061-PA | 224..439 | 1..216 | 1141 | 98.6 | Plus |