Clone GH10911 Report

Search the DGRC for GH10911

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:109
Well:11
Vector:pOT2
Associated Gene/Transcriptmri-RC
Protein status:GH10911.pep: wuzgold
Preliminary Size:995
Sequenced Size:924

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1216 2001-01-01 Release 2 assignment
CG1216 2002-03-20 Blastp of sequenced clone
CG1216 2003-01-01 Sim4 clustering to Release 3
mri 2008-04-29 Release 5.5 accounting
mri 2008-08-15 Release 5.9 accounting
mri 2008-12-18 5.12 accounting

Clone Sequence Records

GH10911.complete Sequence

924 bp (924 high quality bases) assembled on 2002-03-20

GenBank Submission: AY094703

> GH10911.complete
TTTTCCGTCTCTTTCCTTGTAACATGCCCTCTGTTATGTTTGACATAAAG
GAGGCCTTCTCCACGAGCTTAGCAACGAAGGAGCGCGACAACAATTTGAA
CTCTTTCTTGAGGACCTAATTCTGCCCCTCATGGTGGCCTCGGCGCAGCG
CGGGGATCGAGAGTGTCACGTTGTGGTGCTCCTTGAAGACGATATGGTCG
AGTGGGATGAAGAGTTTCCGCCTCAGATGGGCGAGGAGTATTGTCAGACC
GTGCACAGCACTGCCATGCACCGATTCTTCAAGTACATCGAGAACCGCGA
TGTGGCCAAACAGGTGATGAAGGATCGCGGTCTGAAGAAGATACGCTGTG
GCATAGAGGGATACCCCACCCACAAAGAGAAGATCCGAAGGCGTCCCGGT
GGACGGGCTGAAGTCATCTACAGCTATGTGCAGCGACCTTTCATCCACAT
GTCCTGGGAGAAGGAGGAAGCAAAGAGTCGCCATGTTGATTTCCAATGTG
TAAAATCCAAGTCTGTAACGAATCTAGCGGAAGCAAATGCAGATCCGCCA
CTGGAATTGGACGCAAGTGGAAATCCGATTCCCCCTATAGCAGTGGCTAA
TCCGCATCCCAATAACGCTGAGCTCGCTGCCGGTATGGCCGTCGCACCCG
CAGCTATAGGCGTGGCTGGTCCAGCAGTCGTGGTAGCCGTCGACGAGGCG
GCCGGGGGCGTTGTAATGCTCAACGAGTTGGACCAGGCAGCGATCGCTGT
TGCCGTCGGAATAGTTGATGAAAATATGTAGATCAACTGACCGGCTGGTA
GTCGGAACACACTGCCAGAGCATCACAGCGCACAGAAAAACACTTTACGT
TTTTAATTAACATTTTTATATGTATATGTAATAAATGGAAATTTCGAATA
CGAAAAAAAAAAAAAAAAAAAAAA

GH10911.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:19:33
Subject Length Description Subject Range Query Range Score Percent Strand
mri-RC 1046 mri-RC 132..1038 1..907 4535 100 Plus
mri.a 919 mri.a 1..911 1..907 4470 99.5 Plus
mri-RB 1654 mri-RB 790..1646 51..907 4285 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:58:24
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 201772..202107 567..902 1680 100 Plus
chr3L 24539361 chr3L 201396..201716 249..569 1605 100 Plus
chr3L 24539361 chr3L 201076..201323 1..248 1240 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:43:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:58:22
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 201817..202157 567..907 1705 100 Plus
3L 28110227 3L 201441..201761 249..569 1605 100 Plus
3L 28110227 3L 201121..201368 1..248 1240 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:49:09
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 201817..202157 567..907 1705 100 Plus
3L 28103327 3L 201441..201761 249..569 1605 100 Plus
3L 28103327 3L 201121..201368 1..248 1240 100 Plus
Blast to na_te.dros performed 2019-03-16 09:58:23
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy11 4428 gypsy11 GYPSY11 4428bp 1208..1253 887..842 113 71.7 Minus

GH10911.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:59:30 Download gff for GH10911.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 201396..201713 249..566 100 -> Plus
chr3L 201076..201323 1..248 100 -> Plus
chr3L 201772..202107 567..902 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:34:21 Download gff for GH10911.complete
Subject Subject Range Query Range Percent Splice Strand
mri-RA 584..1320 43..781 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:25:08 Download gff for GH10911.complete
Subject Subject Range Query Range Percent Splice Strand
mri-RA 584..1320 43..781 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:53:54 Download gff for GH10911.complete
Subject Subject Range Query Range Percent Splice Strand
mri-RB 584..1320 43..781 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:00:43 Download gff for GH10911.complete
Subject Subject Range Query Range Percent Splice Strand
mri-RA 584..1320 43..781 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:51:09 Download gff for GH10911.complete
Subject Subject Range Query Range Percent Splice Strand
mri-RB 584..1320 43..781 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:51:44 Download gff for GH10911.complete
Subject Subject Range Query Range Percent Splice Strand
mri-RC 1..902 1..902 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:25:08 Download gff for GH10911.complete
Subject Subject Range Query Range Percent Splice Strand
mri-RC 1..902 1..902 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:53:54 Download gff for GH10911.complete
Subject Subject Range Query Range Percent Splice Strand
mri-RB 790..1647 43..902 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:00:43 Download gff for GH10911.complete
Subject Subject Range Query Range Percent Splice Strand
mri-RC 1..902 1..902 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:51:09 Download gff for GH10911.complete
Subject Subject Range Query Range Percent Splice Strand
mri-RB 790..1647 43..902 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:59:30 Download gff for GH10911.complete
Subject Subject Range Query Range Percent Splice Strand
3L 201817..202152 567..902 100   Plus
3L 201121..201368 1..248 100 -> Plus
3L 201441..201758 249..566 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:59:30 Download gff for GH10911.complete
Subject Subject Range Query Range Percent Splice Strand
3L 201817..202152 567..902 100   Plus
3L 201121..201368 1..248 100 -> Plus
3L 201441..201758 249..566 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:59:30 Download gff for GH10911.complete
Subject Subject Range Query Range Percent Splice Strand
3L 201817..202152 567..902 100   Plus
3L 201121..201368 1..248 100 -> Plus
3L 201441..201758 249..566 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:53:54 Download gff for GH10911.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 201121..201368 1..248 100 -> Plus
arm_3L 201441..201758 249..566 100 -> Plus
arm_3L 201817..202152 567..902 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:33:49 Download gff for GH10911.complete
Subject Subject Range Query Range Percent Splice Strand
3L 201121..201368 1..248 100 -> Plus
3L 201441..201758 249..566 100 -> Plus
3L 201817..202152 567..902 100   Plus

GH10911.hyp Sequence

Translation from 130 to 780

> GH10911.hyp
MVASAQRGDRECHVVVLLEDDMVEWDEEFPPQMGEEYCQTVHSTAMHRFF
KYIENRDVAKQVMKDRGLKKIRCGIEGYPTHKEKIRRRPGGRAEVIYSYV
QRPFIHMSWEKEEAKSRHVDFQCVKSKSVTNLAEANADPPLELDASGNPI
PPIAVANPHPNNAELAAGMAVAPAAIGVAGPAVVVAVDEAAGGVVMLNEL
DQAAIAVAVGIVDENM*

GH10911.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:55:53
Subject Length Description Subject Range Query Range Score Percent Strand
mri-PE 438 CG1216-PE 223..438 1..216 1126 100 Plus
mri-PA 439 CG1216-PA 224..439 1..216 1126 100 Plus
mri-PB 439 CG1216-PB 224..439 1..216 1126 100 Plus

GH10911.pep Sequence

Translation from 130 to 780

> GH10911.pep
MVASAQRGDRECHVVVLLEDDMVEWDEEFPPQMGEEYCQTVHSTAMHRFF
KYIENRDVAKQVMKDRGLKKIRCGIEGYPTHKEKIRRRPGGRAEVIYSYV
QRPFIHMSWEKEEAKSRHVDFQCVKSKSVTNLAEANADPPLELDASGNPI
PPIAVANPHPNNAELAAGMAVAPAAIGVAGPAVVVAVDEAAGGVVMLNEL
DQAAIAVAVGIVDENM*

GH10911.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:30:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23868-PA 433 GF23868-PA 219..433 1..216 955 93.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:30:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14698-PA 439 GG14698-PA 224..439 1..216 1144 99.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:30:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15823-PA 487 GH15823-PA 265..487 1..216 888 82.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:37:07
Subject Length Description Subject Range Query Range Score Percent Strand
mri-PE 438 CG1216-PE 223..438 1..216 1126 100 Plus
mri-PA 439 CG1216-PA 224..439 1..216 1126 100 Plus
mri-PB 439 CG1216-PB 224..439 1..216 1126 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:30:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12605-PA 449 GI12605-PA 237..449 1..216 870 84.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:30:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16111-PA 455 GL16111-PA 248..455 1..216 934 89.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:30:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28384-PA 453 GA28384-PA 246..453 1..216 934 89.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:30:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14314-PA 379 GM14314-PA 224..362 1..139 769 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:30:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13551-PA 439 GD13551-PA 224..438 1..215 1136 99.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:30:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12727-PA 469 GJ12727-PA 250..469 1..216 885 84.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:30:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17332-PA 478 GK17332-PA 260..472 1..204 855 85 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:30:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21061-PA 439 GE21061-PA 224..439 1..216 1141 98.6 Plus