Clone GH10915 Report

Search the DGRC for GH10915

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:109
Well:15
Vector:pOT2
Associated Gene/TranscriptCG6272-RA
Protein status:GH10915.pep: gold
Preliminary Size:551
Sequenced Size:561

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6272 2002-01-01 Sim4 clustering to Release 2
CG6272 2002-05-18 Blastp of sequenced clone
CG6272 2003-01-01 Sim4 clustering to Release 3
CG6272 2008-04-29 Release 5.5 accounting
CG6272 2008-08-15 Release 5.9 accounting
CG6272 2008-12-18 5.12 accounting

Clone Sequence Records

GH10915.complete Sequence

561 bp (561 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118768

> GH10915.complete
CTGTGTTTTCTTCTGCATTTCCGTCCGATTGCGATCCAATTTGAACTAAA
TAAATATCAGTATTATCACGGAGATAATGCCGGCCAAAAAGAGAACTGCC
GCGTCGACCAGCAAAAATAGCGATTCGCCATTAAGTCCGCACACAGACGA
TCCAGCGTACAAAGAAAAAAGAAAGAAAAACAATGAGGCTGTTCAGCGCA
CACGCGAAAAGACCAAGAAATCGGCCGAGGAACGTAAGAAACGCATCGAT
GATTTGAGGAAGCAAAACGATGCTCTTAAGGTTCAGATCGAGACGAGTGA
AAAACATATATCTACGCTTAGAGATCTGATCATTCAGGGTGAGAAAACGG
AGGACGGCCATCGAATCATCCAGGAGATTCTCGCTGAACCAGATCCCGAT
CCCAAGGACAATGACTAACGAGGAGCTTCTCCTGATTTACCTTCTTATAT
TTTCATACTTTTAAGCCATTTCCCATGGTTGTTAACCATGTGTATCATCT
TAGTTTTTCGATTAAAATGGTGCAATTGCTCGAATTCTATTACAAAAAAA
AAAAAAAAAAA

GH10915.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:45:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG6272-RA 637 CG6272-RA 23..568 1..546 2730 100 Plus
APP-BP1.d 2525 APP-BP1.d 590..685 96..1 480 100 Minus
APP-BP1.b 2532 APP-BP1.b 590..685 96..1 480 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:38:11
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 11088399..11088756 543..186 1790 100 Minus
chr3L 24539361 chr3L 11088881..11089068 188..1 940 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 16:43:33
Subject Length Description Subject Range Query Range Score Percent Strand
pncr011:3L-RA 874 CR33947-RA 405..500 96..1 480 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:38:09
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11097514..11097874 546..186 1805 100 Minus
3L 28110227 3L 11097999..11098186 188..1 940 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:26:46
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 11090614..11090974 546..186 1805 100 Minus
3L 28103327 3L 11091099..11091286 188..1 940 100 Minus
Blast to na_te.dros performed on 2019-03-15 15:38:10 has no hits.

GH10915.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:39:12 Download gff for GH10915.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 11088399..11088754 188..543 100 <- Minus
chr3L 11088882..11089068 1..187 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:34:24 Download gff for GH10915.complete
Subject Subject Range Query Range Percent Splice Strand
CG6272-RA 1..342 77..418 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:31:55 Download gff for GH10915.complete
Subject Subject Range Query Range Percent Splice Strand
CG6272-RA 1..342 77..418 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:34:08 Download gff for GH10915.complete
Subject Subject Range Query Range Percent Splice Strand
CG6272-RA 1..342 77..418 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:16:44 Download gff for GH10915.complete
Subject Subject Range Query Range Percent Splice Strand
CG6272-RA 1..342 77..418 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:11:05 Download gff for GH10915.complete
Subject Subject Range Query Range Percent Splice Strand
CG6272-RA 1..342 77..418 100   Plus
Sim4 to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 16:43:34 Download gff for GH10915.complete
Subject Subject Range Query Range Percent Splice Strand
pncr011:3L-RA 401..500 1..101 98   Minus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:44:35 Download gff for GH10915.complete
Subject Subject Range Query Range Percent Splice Strand
CG6272-RA 1..543 1..543 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:31:55 Download gff for GH10915.complete
Subject Subject Range Query Range Percent Splice Strand
CG6272-RA 1..543 1..543 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:34:08 Download gff for GH10915.complete
Subject Subject Range Query Range Percent Splice Strand
CG6272-RA 1..543 1..543 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:16:44 Download gff for GH10915.complete
Subject Subject Range Query Range Percent Splice Strand
CG6272-RA 1..543 1..543 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:11:05 Download gff for GH10915.complete
Subject Subject Range Query Range Percent Splice Strand
CG6272-RA 1..543 1..543 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:39:12 Download gff for GH10915.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11097517..11097872 188..543 100 <- Minus
3L 11098000..11098186 1..187 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:39:12 Download gff for GH10915.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11097517..11097872 188..543 100 <- Minus
3L 11098000..11098186 1..187 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:39:12 Download gff for GH10915.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11097517..11097872 188..543 100 <- Minus
3L 11098000..11098186 1..187 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:34:08 Download gff for GH10915.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11090617..11090972 188..543 100 <- Minus
arm_3L 11091100..11091286 1..187 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:55:51 Download gff for GH10915.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11090617..11090972 188..543 100 <- Minus
3L 11091100..11091286 1..187 100   Minus

GH10915.hyp Sequence

Translation from 76 to 417

> GH10915.hyp
MPAKKRTAASTSKNSDSPLSPHTDDPAYKEKRKKNNEAVQRTREKTKKSA
EERKKRIDDLRKQNDALKVQIETSEKHISTLRDLIIQGEKTEDGHRIIQE
ILAEPDPDPKDND*

GH10915.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:56:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG6272-PB 113 CG6272-PB 1..113 1..113 577 100 Plus
CG6272-PA 113 CG6272-PA 1..113 1..113 577 100 Plus

GH10915.pep Sequence

Translation from 76 to 417

> GH10915.pep
MPAKKRTAASTSKNSDSPLSPHTDDPAYKEKRKKNNEAVQRTREKTKKSA
EERKKRIDDLRKQNDALKVQIETSEKHISTLRDLIIQGEKTEDGHRIIQE
ILAEPDPDPKDND*

GH10915.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:07:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10550-PA 116 GF10550-PA 1..116 1..113 413 72.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:07:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13942-PA 109 GG13942-PA 1..106 1..107 473 88.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:07:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16258-PA 115 GH16258-PA 1..102 1..102 282 59.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:21:43
Subject Length Description Subject Range Query Range Score Percent Strand
Irbp18-PB 113 CG6272-PB 1..113 1..113 577 100 Plus
Irbp18-PA 113 CG6272-PA 1..113 1..113 577 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:07:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13192-PA 121 GI13192-PA 1..111 1..111 248 48.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:07:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24916-PA 123 GL24916-PA 1..108 1..105 389 71.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:07:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19480-PA 123 GA19480-PA 1..108 1..105 389 71.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:07:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24777-PA 111 GM24777-PA 1..111 1..113 529 95.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:07:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12828-PA 111 GD12828-PA 1..111 1..113 536 96.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:07:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11967-PA 117 GJ11967-PA 1..113 1..113 280 54.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:07:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12307-PA 127 GK12307-PA 1..127 1..112 327 56.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:07:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20240-PA 111 GE20240-PA 1..111 1..113 500 89.4 Plus