BDGP Sequence Production Resources |
Search the DGRC for GH10915
Library: | GH |
Tissue Source: | Drosophila melanogaster head |
Created by: | Ling Hong |
Date Registered: | 1998-06-02 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 109 |
Well: | 15 |
Vector: | pOT2 |
Associated Gene/Transcript | CG6272-RA |
Protein status: | GH10915.pep: gold |
Preliminary Size: | 551 |
Sequenced Size: | 561 |
Gene | Date | Evidence |
---|---|---|
CG6272 | 2002-01-01 | Sim4 clustering to Release 2 |
CG6272 | 2002-05-18 | Blastp of sequenced clone |
CG6272 | 2003-01-01 | Sim4 clustering to Release 3 |
CG6272 | 2008-04-29 | Release 5.5 accounting |
CG6272 | 2008-08-15 | Release 5.9 accounting |
CG6272 | 2008-12-18 | 5.12 accounting |
561 bp (561 high quality bases) assembled on 2002-05-18
GenBank Submission: AY118768
> GH10915.complete CTGTGTTTTCTTCTGCATTTCCGTCCGATTGCGATCCAATTTGAACTAAA TAAATATCAGTATTATCACGGAGATAATGCCGGCCAAAAAGAGAACTGCC GCGTCGACCAGCAAAAATAGCGATTCGCCATTAAGTCCGCACACAGACGA TCCAGCGTACAAAGAAAAAAGAAAGAAAAACAATGAGGCTGTTCAGCGCA CACGCGAAAAGACCAAGAAATCGGCCGAGGAACGTAAGAAACGCATCGAT GATTTGAGGAAGCAAAACGATGCTCTTAAGGTTCAGATCGAGACGAGTGA AAAACATATATCTACGCTTAGAGATCTGATCATTCAGGGTGAGAAAACGG AGGACGGCCATCGAATCATCCAGGAGATTCTCGCTGAACCAGATCCCGAT CCCAAGGACAATGACTAACGAGGAGCTTCTCCTGATTTACCTTCTTATAT TTTCATACTTTTAAGCCATTTCCCATGGTTGTTAACCATGTGTATCATCT TAGTTTTTCGATTAAAATGGTGCAATTGCTCGAATTCTATTACAAAAAAA AAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
pncr011:3L-RA | 874 | CR33947-RA | 405..500 | 96..1 | 480 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 11088399..11088754 | 188..543 | 100 | <- | Minus |
chr3L | 11088882..11089068 | 1..187 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6272-RA | 1..342 | 77..418 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6272-RA | 1..342 | 77..418 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6272-RA | 1..342 | 77..418 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6272-RA | 1..342 | 77..418 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6272-RA | 1..342 | 77..418 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
pncr011:3L-RA | 401..500 | 1..101 | 98 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6272-RA | 1..543 | 1..543 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6272-RA | 1..543 | 1..543 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6272-RA | 1..543 | 1..543 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6272-RA | 1..543 | 1..543 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6272-RA | 1..543 | 1..543 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 11097517..11097872 | 188..543 | 100 | <- | Minus |
3L | 11098000..11098186 | 1..187 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 11097517..11097872 | 188..543 | 100 | <- | Minus |
3L | 11098000..11098186 | 1..187 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 11097517..11097872 | 188..543 | 100 | <- | Minus |
3L | 11098000..11098186 | 1..187 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 11090617..11090972 | 188..543 | 100 | <- | Minus |
arm_3L | 11091100..11091286 | 1..187 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 11090617..11090972 | 188..543 | 100 | <- | Minus |
3L | 11091100..11091286 | 1..187 | 100 | Minus |
Translation from 76 to 417
> GH10915.hyp MPAKKRTAASTSKNSDSPLSPHTDDPAYKEKRKKNNEAVQRTREKTKKSA EERKKRIDDLRKQNDALKVQIETSEKHISTLRDLIIQGEKTEDGHRIIQE ILAEPDPDPKDND*
Translation from 76 to 417
> GH10915.pep MPAKKRTAASTSKNSDSPLSPHTDDPAYKEKRKKNNEAVQRTREKTKKSA EERKKRIDDLRKQNDALKVQIETSEKHISTLRDLIIQGEKTEDGHRIIQE ILAEPDPDPKDND*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF10550-PA | 116 | GF10550-PA | 1..116 | 1..113 | 413 | 72.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG13942-PA | 109 | GG13942-PA | 1..106 | 1..107 | 473 | 88.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH16258-PA | 115 | GH16258-PA | 1..102 | 1..102 | 282 | 59.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Irbp18-PB | 113 | CG6272-PB | 1..113 | 1..113 | 577 | 100 | Plus |
Irbp18-PA | 113 | CG6272-PA | 1..113 | 1..113 | 577 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI13192-PA | 121 | GI13192-PA | 1..111 | 1..111 | 248 | 48.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24916-PA | 123 | GL24916-PA | 1..108 | 1..105 | 389 | 71.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA19480-PA | 123 | GA19480-PA | 1..108 | 1..105 | 389 | 71.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM24777-PA | 111 | GM24777-PA | 1..111 | 1..113 | 529 | 95.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD12828-PA | 111 | GD12828-PA | 1..111 | 1..113 | 536 | 96.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ11967-PA | 117 | GJ11967-PA | 1..113 | 1..113 | 280 | 54.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK12307-PA | 127 | GK12307-PA | 1..127 | 1..112 | 327 | 56.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE20240-PA | 111 | GE20240-PA | 1..111 | 1..113 | 500 | 89.4 | Plus |