Clone GH11112 Report

Search the DGRC for GH11112

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:111
Well:12
Vector:pOT2
Associated Gene/TranscriptCG1927-RA
Protein status:GH11112.pep: gold
Preliminary Size:1176
Sequenced Size:1188

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1927 2000-02-14 Blastp of sequenced clone
CG5687 2001-01-01 Release 2 assignment
CG1927 2001-01-01 Release 2 assignment
CG1960 2001-01-01 Release 2 assignment
CG5691 2001-01-01 Release 2 assignment
CG11814 2001-01-01 Release 2 assignment
CG1927 2003-01-01 Sim4 clustering to Release 3
CG1927 2008-04-29 Release 5.5 accounting
CG1927 2008-08-15 Release 5.9 accounting
CG1927 2008-12-18 5.12 accounting

Clone Sequence Records

GH11112.complete Sequence

1188 bp (1188 high quality bases) assembled on 2000-02-14

GenBank Submission: AF145665

> GH11112.complete
AAAAAGTTCGAGTTCGCCGAGAGAAGCGTGAAAATCCGATATCGAAACTA
CGTTTTTTTTTTAGTCATTATACCGATTGGCTATGCAAATTTAATTGCGG
ATCTCCCAAATCATCGAAAAGCCAACAGGTCGCCCCTCAACCAAAATAAA
CACAACAATCGAGCCGCAAATGAAACGGGCAAAAACAGCAAAGGCAACTG
GCGAACCGCTTAACCGGTTTCGAAATATCCATCGTAGCACAGTTTCCTCG
TCCATATAATATTCCGATTGCAGTGGATCAAAATATACACACACACACTC
GCATATAAATTCGCAGATATACGTTGTTTGTGTGAGTTTCTGTTTGTGGT
TCGCGTGAAAAATAGTTTTGACAAATAAATACAAAGCCAGACGCCGACAT
AACTGTGAAAATAAACCATAAGCCAGACAGCAGCCATGGGTTATTCCATT
AAGAACTGCGAAACGGGTGAGTTGGAGTACTTCTACACAGACACCGTCCG
CGTTAATAGACCGGCCTTCGATGAGGAGACCGGTGAACCGATCCACGACC
AGGTGACCAAGGTTCACTTCCGCAAACACACGAATTTCCATGTACCCAAG
CACTATCTCCGCGGAACCATATGCGATGAGGTAGACGACGAGCTGGCCAA
TACGGTGAGATATGGGGCAGCCACCGCGATTCCCAACAGGGCACCCAAAA
AGGTCACTCCGGGCTACGAACGCGAGGACTATTGTCAAATGGATGGCGTG
AGCAACAACATAATCCTGGGCTACAACCGCAACCCCTACTTGCTGTTCCT
GGTGCCCACGCTCTTCTGCTACAACTTCGTCATTGGAGCCACGCTGGCCC
TCATCGAGATCGTCCTGCACATGATGTCCCACCACAGGAACGGTCTCACC
ATGCAGAAGAGCCTGTACTTCCGTAGTCCACTCAACGTGCTGTCCTCGCA
GTTCTGCGCCATCTGCCGCACGGAAACCGACAGCAAGTACAACCGCATCT
TCGATATCCTTAACAAGCAGATGCGCAACGCACATCGCTCCGAGGCGCTG
AAGGACATGGCCAAGGCAATTGGATAAGCTGGGAGAGATTCGATTTGATA
TGGTCCATATATTTAACACAAATGTTTTTGTCACACGGTCAACAAAAAAT
AAATGCACTCGTTTATCACTCAAAAAAAAAAAAAAAAA

GH11112.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:41:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG1927-RA 1289 CG1927-RA 83..1255 1..1173 5865 100 Plus
CG1140.a 1704 CG1140.a 1619..1704 1173..1088 430 100 Minus
CG1140-RA 1802 CG1140-RA 1717..1802 1173..1088 430 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:54:42
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 1969162..1969614 453..1 2265 100 Minus
chr3L 24539361 chr3L 1966287..1966701 1171..757 2075 100 Minus
chr3L 24539361 chr3L 1966762..1967066 756..452 1525 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:43:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:54:40
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1969600..1970052 453..1 2265 100 Minus
3L 28110227 3L 1966723..1967139 1173..757 2085 100 Minus
3L 28110227 3L 1967200..1967504 756..452 1525 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:02:50
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 1969600..1970052 453..1 2265 100 Minus
3L 28103327 3L 1966723..1967139 1173..757 2085 100 Minus
3L 28103327 3L 1967200..1967504 756..452 1525 100 Minus
Blast to na_te.dros performed on 2019-03-16 23:54:41 has no hits.

GH11112.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:55:31 Download gff for GH11112.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 1966287..1966701 757..1171 100 <- Minus
chr3L 1966762..1967064 454..756 100 <- Minus
chr3L 1969162..1969614 1..453 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:34:50 Download gff for GH11112.complete
Subject Subject Range Query Range Percent Splice Strand
CG1927-RA 1..642 436..1077 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:34:41 Download gff for GH11112.complete
Subject Subject Range Query Range Percent Splice Strand
CG1927-RA 1..642 436..1077 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:53:09 Download gff for GH11112.complete
Subject Subject Range Query Range Percent Splice Strand
CG1927-RA 1..642 436..1077 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:09:21 Download gff for GH11112.complete
Subject Subject Range Query Range Percent Splice Strand
CG1927-RA 1..642 436..1077 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:03:29 Download gff for GH11112.complete
Subject Subject Range Query Range Percent Splice Strand
CG1927-RA 1..642 436..1077 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:37:16 Download gff for GH11112.complete
Subject Subject Range Query Range Percent Splice Strand
CG1927-RA 24..1194 1..1171 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:34:40 Download gff for GH11112.complete
Subject Subject Range Query Range Percent Splice Strand
CG1927-RA 24..1194 1..1171 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:53:09 Download gff for GH11112.complete
Subject Subject Range Query Range Percent Splice Strand
CG1927-RA 28..1198 1..1171 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:09:21 Download gff for GH11112.complete
Subject Subject Range Query Range Percent Splice Strand
CG1927-RA 24..1194 1..1171 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:03:29 Download gff for GH11112.complete
Subject Subject Range Query Range Percent Splice Strand
CG1927-RA 28..1198 1..1171 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:55:31 Download gff for GH11112.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1966725..1967139 757..1171 100 <- Minus
3L 1967200..1967502 454..756 100 <- Minus
3L 1969600..1970052 1..453 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:55:31 Download gff for GH11112.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1966725..1967139 757..1171 100 <- Minus
3L 1967200..1967502 454..756 100 <- Minus
3L 1969600..1970052 1..453 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:55:31 Download gff for GH11112.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1966725..1967139 757..1171 100 <- Minus
3L 1967200..1967502 454..756 100 <- Minus
3L 1969600..1970052 1..453 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:53:09 Download gff for GH11112.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1966725..1967139 757..1171 100 <- Minus
arm_3L 1967200..1967502 454..756 100 <- Minus
arm_3L 1969600..1970052 1..453 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:46:52 Download gff for GH11112.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1966725..1967139 757..1171 100 <- Minus
3L 1967200..1967502 454..756 100 <- Minus
3L 1969600..1970052 1..453 100   Minus

GH11112.pep Sequence

Translation from 435 to 1076

> GH11112.pep
MGYSIKNCETGELEYFYTDTVRVNRPAFDEETGEPIHDQVTKVHFRKHTN
FHVPKHYLRGTICDEVDDELANTVRYGAATAIPNRAPKKVTPGYEREDYC
QMDGVSNNIILGYNRNPYLLFLVPTLFCYNFVIGATLALIEIVLHMMSHH
RNGLTMQKSLYFRSPLNVLSSQFCAICRTETDSKYNRIFDILNKQMRNAH
RSEALKDMAKAIG*

GH11112.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:29:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24943-PA 214 GF24943-PA 1..214 1..213 914 79.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:29:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14541-PA 213 GG14541-PA 1..213 1..213 1065 92 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:29:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16499-PA 223 GH16499-PA 1..223 1..213 767 64.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:26:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG1927-PA 213 CG1927-PA 1..213 1..213 1140 100 Plus
CG1927-PB 210 CG1927-PB 4..210 7..213 1109 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:29:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12175-PA 218 GI12175-PA 4..218 7..213 709 63.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:29:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22661-PA 215 GL22661-PA 1..215 1..213 868 74.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:29:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15136-PA 215 GA15136-PA 1..215 1..213 863 73.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:29:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14150-PA 213 GM14150-PA 1..213 1..213 1069 93 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:29:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13420-PA 213 GD13420-PA 1..213 1..213 1093 94.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:29:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13450-PA 222 GJ13450-PA 1..222 1..213 798 67.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:29:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12609-PA 227 GK12609-PA 2..227 5..213 751 64.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:29:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20895-PA 211 GE20895-PA 1..211 1..213 1054 91.5 Plus

GH11112.hyp Sequence

Translation from 435 to 1076

> GH11112.hyp
MGYSIKNCETGELEYFYTDTVRVNRPAFDEETGEPIHDQVTKVHFRKHTN
FHVPKHYLRGTICDEVDDELANTVRYGAATAIPNRAPKKVTPGYEREDYC
QMDGVSNNIILGYNRNPYLLFLVPTLFCYNFVIGATLALIEIVLHMMSHH
RNGLTMQKSLYFRSPLNVLSSQFCAICRTETDSKYNRIFDILNKQMRNAH
RSEALKDMAKAIG*

GH11112.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:58:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG1927-PA 213 CG1927-PA 1..213 1..213 1140 100 Plus
CG1927-PB 210 CG1927-PB 4..210 7..213 1109 100 Plus