Clone GH11193 Report

Search the DGRC for GH11193

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:111
Well:93
Vector:pOT2
Associated Gene/TranscriptRab18-RA
Protein status:GH11193.pep: gold
Preliminary Size:1300
Sequenced Size:811

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3129 2001-01-01 Release 2 assignment
CG3129 2002-01-03 Blastp of sequenced clone
CG3129 2003-01-01 Sim4 clustering to Release 3
Rab-RP4 2008-04-29 Release 5.5 accounting
Rab-RP4 2008-08-15 Release 5.9 accounting
Rab-RP4 2008-12-18 5.12 accounting

Clone Sequence Records

GH11193.complete Sequence

811 bp (811 high quality bases) assembled on 2002-01-03

GenBank Submission: AY075329

> GH11193.complete
CTCACTTACTCCAGATAATCTACATAAATAATACAATTGGCAATATTCTT
ATCGTTTTAAGTAAATAACAGTAGTGATAAGCATTAAGCGGAGCTCAAAC
CACACAATGGCTGATCGGGCTATCAAGCTGCTGGTGATCGGGGAAAGCGG
CGTGGGCAAGTCCAGTTTGATACGTCGCTTCGTGGAGAACAAGTTCGACC
AGAACCATGACGTCACGATTGGCATGGACTTCAAGAGCAAAGTGATGCAG
GTGGACGGCATAGACTACAAGGTGGCCCTGTGGGATACGGCGGGCGCCGA
GAGATTCCGCAGCCTGACGCCCAGTTTCTATCGGAAGGCTCTGGGCGCCA
TTCTAGTGTACGACATCACCAGCAGGGACAGCCTGGTCAAGCTGGAAACC
TGGCTGGCTGAACTGGATAGCTACAGCGACAATCCCAACATTGCCATCAT
TGTGGTAGGCAACAAGATCGACGAGGAGCGAGTTGTGGATCGCGAGGAGG
GTCGAAAGTTTGCCAGGAAGCACAGGGCGCTCTTCATCGAGACCTCAGCC
AAATGCGATCAGTTCGTCAGCGATGTGTTCAAAGATGTGGTGGAGAAGAT
CGTCTCCTCCGAATACTTCAACAATGGCAATGCCTCCGCCGGTCTGGACA
TCGCCAGCGATCGGGATCTGGAGGCAAGCGCGTCTACGTGTTACTGTTGA
TTTCGAATGTTATGCGTGCTTTTGTCAAATTTATATCGTGTATTTATTTA
ATCGTTTCAATATCACTAGCATAAAGTCAATCAACCTTAAAAAAAAAAAA
AAAAAAAAAAA

GH11193.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:34:28
Subject Length Description Subject Range Query Range Score Percent Strand
Rab-RP4-RA 1082 Rab-RP4-RA 72..861 1..790 3950 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:48:07
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 5563480..5563914 598..164 2160 99.8 Minus
chrX 22417052 chrX 5563226..5563417 788..597 960 100 Minus
chrX 22417052 chrX 5564002..5564166 165..1 825 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:44:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:48:06
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 5671081..5671515 598..164 2175 100 Minus
X 23542271 X 5670825..5671018 790..597 970 100 Minus
X 23542271 X 5671603..5671767 165..1 825 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:02:24
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 5679179..5679613 598..164 2175 100 Minus
X 23527363 X 5678923..5679116 790..597 970 100 Minus
X 23527363 X 5679701..5679865 165..1 825 100 Minus
Blast to na_te.dros performed on 2019-03-16 03:48:06 has no hits.

GH11193.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:48:49 Download gff for GH11193.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 5563226..5563415 599..788 100 <- Minus
chrX 5563480..5563912 166..598 99 <- Minus
chrX 5564002..5564166 1..165 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:35:04 Download gff for GH11193.complete
Subject Subject Range Query Range Percent Splice Strand
Rab-RP4-RA 1..594 107..700 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:56:50 Download gff for GH11193.complete
Subject Subject Range Query Range Percent Splice Strand
Rab-RP4-RA 1..594 107..700 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:04:06 Download gff for GH11193.complete
Subject Subject Range Query Range Percent Splice Strand
Rab18-RA 1..594 107..700 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:21:38 Download gff for GH11193.complete
Subject Subject Range Query Range Percent Splice Strand
Rab-RP4-RA 1..594 107..700 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:15:22 Download gff for GH11193.complete
Subject Subject Range Query Range Percent Splice Strand
Rab18-RA 1..594 107..700 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:21:13 Download gff for GH11193.complete
Subject Subject Range Query Range Percent Splice Strand
Rab-RP4-RA 43..830 1..788 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:56:50 Download gff for GH11193.complete
Subject Subject Range Query Range Percent Splice Strand
Rab-RP4-RA 43..830 1..788 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:04:06 Download gff for GH11193.complete
Subject Subject Range Query Range Percent Splice Strand
Rab18-RA 46..833 1..788 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:21:39 Download gff for GH11193.complete
Subject Subject Range Query Range Percent Splice Strand
Rab-RP4-RA 43..830 1..788 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:15:22 Download gff for GH11193.complete
Subject Subject Range Query Range Percent Splice Strand
Rab18-RA 46..833 1..788 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:48:49 Download gff for GH11193.complete
Subject Subject Range Query Range Percent Splice Strand
X 5670827..5671016 599..788 100 <- Minus
X 5671081..5671513 166..598 100 <- Minus
X 5671603..5671767 1..165 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:48:49 Download gff for GH11193.complete
Subject Subject Range Query Range Percent Splice Strand
X 5670827..5671016 599..788 100 <- Minus
X 5671081..5671513 166..598 100 <- Minus
X 5671603..5671767 1..165 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:48:49 Download gff for GH11193.complete
Subject Subject Range Query Range Percent Splice Strand
X 5670827..5671016 599..788 100 <- Minus
X 5671081..5671513 166..598 100 <- Minus
X 5671603..5671767 1..165 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:04:06 Download gff for GH11193.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 5564860..5565049 599..788 100 <- Minus
arm_X 5565114..5565546 166..598 100 <- Minus
arm_X 5565636..5565800 1..165 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:56:27 Download gff for GH11193.complete
Subject Subject Range Query Range Percent Splice Strand
X 5679179..5679611 166..598 100 <- Minus
X 5679701..5679865 1..165 100   Minus
X 5678925..5679114 599..788 100 <- Minus

GH11193.pep Sequence

Translation from 106 to 699

> GH11193.pep
MADRAIKLLVIGESGVGKSSLIRRFVENKFDQNHDVTIGMDFKSKVMQVD
GIDYKVALWDTAGAERFRSLTPSFYRKALGAILVYDITSRDSLVKLETWL
AELDSYSDNPNIAIIVVGNKIDEERVVDREEGRKFARKHRALFIETSAKC
DQFVSDVFKDVVEKIVSSEYFNNGNASAGLDIASDRDLEASASTCYC*

GH11193.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:00:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20909-PA 198 GF20909-PA 1..198 1..197 951 91.9 Plus
Dana\GF11067-PA 213 GF11067-PA 8..191 7..186 386 42.5 Plus
Dana\GF11646-PA 213 GF11646-PA 6..177 3..169 359 44.5 Plus
Dana\GF15280-PA 219 GF15280-PA 31..202 7..177 352 41.6 Plus
Dana\GF20241-PA 204 GF20241-PA 7..171 3..166 343 41 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:00:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18481-PA 197 GG18481-PA 1..197 1..197 1008 97.5 Plus
Dere\GG23219-PA 213 GG23219-PA 8..191 7..186 386 42.5 Plus
Dere\GG21802-PA 213 GG21802-PA 6..177 3..169 359 44.5 Plus
Dere\GG24527-PA 219 GG24527-PA 31..202 7..177 352 41.6 Plus
Dere\GG19277-PA 204 GG19277-PA 7..171 3..166 338 41.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:00:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12045-PA 197 GH12045-PA 1..197 1..197 906 86.8 Plus
Dgri\GH21751-PA 213 GH21751-PA 8..190 7..185 386 42.7 Plus
Dgri\GH20926-PA 213 GH20926-PA 6..177 3..169 360 44.5 Plus
Dgri\GH13785-PA 216 GH13785-PA 30..189 7..165 345 42.9 Plus
Dgri\GH12621-PA 204 GH12621-PA 7..171 3..166 339 41.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:15:21
Subject Length Description Subject Range Query Range Score Percent Strand
Rab18-PA 197 CG3129-PA 1..197 1..197 998 100 Plus
Rab2-PB 213 CG3269-PB 8..183 7..177 379 43.5 Plus
Rab2-PA 213 CG3269-PA 8..183 7..177 379 43.5 Plus
Rab4-PA 213 CG4921-PA 6..177 3..169 354 44.5 Plus
Rab4-PB 213 CG4921-PB 6..177 3..169 354 44.5 Plus
Rab30-PD 223 CG9100-PD 9..193 7..192 348 39 Plus
Rab30-PC 223 CG9100-PC 9..193 7..192 348 39 Plus
Rab30-PB 223 CG9100-PB 9..193 7..192 348 39 Plus
Rab30-PA 223 CG9100-PA 9..193 7..192 348 39 Plus
Rab5-PI 219 CG3664-PI 31..202 7..177 346 41.6 Plus
Rab5-PH 219 CG3664-PH 31..202 7..177 346 41.6 Plus
Rab5-PG 219 CG3664-PG 31..202 7..177 346 41.6 Plus
Rab5-PE 219 CG3664-PE 31..202 7..177 346 41.6 Plus
Rab5-PC 219 CG3664-PC 31..202 7..177 346 41.6 Plus
Rab5-PD 219 CG3664-PD 31..202 7..177 346 41.6 Plus
Rab5-PF 219 CG3664-PF 31..202 7..177 346 41.6 Plus
Rab5-PB 219 CG3664-PB 31..202 7..177 346 41.6 Plus
Rab5-PA 219 CG3664-PA 31..202 7..177 346 41.6 Plus
Rab10-PA 204 CG17060-PA 7..171 3..166 339 41.6 Plus
Rab11-PA 214 CG5771-PA 9..172 3..165 333 42.4 Plus
Rab11-PB 214 CG5771-PB 9..172 3..165 333 42.4 Plus
Rab14-PD 215 CG4212-PD 13..172 7..165 333 42.9 Plus
Rab14-PA 215 CG4212-PA 13..172 7..165 333 42.9 Plus
Rab14-PB 239 CG4212-PB 37..196 7..165 333 42.9 Plus
Rab26-PE 410 CG34410-PE 214..380 7..170 331 39.9 Plus
Rab26-PD 410 CG34410-PD 214..380 7..170 331 39.9 Plus
Rab26-PC 410 CG34410-PC 214..380 7..170 331 39.9 Plus
Rab19-PB 219 CG7062-PP3-RB 19..216 3..195 330 37.7 Plus
Rab19-PA 219 CG7062-PA 19..216 3..195 330 37.7 Plus
RabX4-PA 213 CG31118-PA 10..170 7..165 326 38.3 Plus
Rab9Fb-PA 214 CG32670-PA 5..161 3..158 326 45.9 Plus
Rab35-PB 201 CG9575-PB 6..178 3..175 325 37.7 Plus
Rab35-PD 201 CG9575-PD 6..178 3..175 325 37.7 Plus
Rab35-PA 201 CG9575-PA 6..178 3..175 325 37.7 Plus
Rab1-PA 205 CG3320-PA 9..204 3..195 325 38.9 Plus
Rab6-PB 208 CG6601-PB 11..181 4..173 322 40.1 Plus
Rab6-PA 208 CG6601-PA 11..181 4..173 322 40.1 Plus
Rab39-PB 218 CG12156-PB 11..184 7..170 319 39.7 Plus
Rab39-PA 218 CG12156-PA 11..184 7..170 319 39.7 Plus
Rab3-PB 220 CG7576-PB 19..182 3..165 311 40.6 Plus
Rab3-PA 220 CG7576-PA 19..182 3..165 311 40.6 Plus
Rab21-PC 222 CG17515-PC 15..169 7..159 309 42.9 Plus
Rab21-PD 222 CG17515-PD 15..169 7..159 309 42.9 Plus
Rab8-PC 207 CG8287-PC 6..169 3..165 304 37.6 Plus
Rab8-PA 207 CG8287-PA 6..169 3..165 304 37.6 Plus
Rab26-PG 388 CG34410-PG 192..358 7..170 300 37.5 Plus
Rab26-PB 388 CG34410-PB 192..358 7..170 300 37.5 Plus
Rab27-PC 230 CG14791-PC 9..178 3..166 288 37.2 Plus
Rab35-PC 190 CG9575-PC 4..167 12..175 283 35.5 Plus
RabX2-PA 195 CG2885-PA 5..176 3..173 282 36.4 Plus
Rab9-PA 256 CG9994-PA 11..171 4..158 282 39.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:00:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16298-PA 195 GI16298-PA 1..195 1..197 886 84.8 Plus
Dmoj\GI19298-PA 213 GI19298-PA 8..190 7..185 386 42.7 Plus
Dmoj\GI18364-PA 213 GI18364-PA 6..177 3..169 358 44.5 Plus
Dmoj\GI17188-PA 216 GI17188-PA 30..189 7..165 346 42.9 Plus
Dmoj\GI11034-PA 204 GI11034-PA 7..171 3..166 338 41.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:00:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18325-PA 197 GL18325-PA 1..197 1..197 923 90.4 Plus
Dper\GL11116-PA 213 GL11116-PA 8..191 7..186 386 42.5 Plus
Dper\GL11470-PA 213 GL11470-PA 6..177 3..169 359 44.5 Plus
Dper\GL19400-PA 218 GL19400-PA 30..201 7..177 352 41.6 Plus
Dper\GL21269-PA 239 GL21269-PA 37..196 7..165 341 42.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:00:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16152-PA 197 GA16152-PA 1..197 1..197 923 90.4 Plus
Dpse\GA17076-PA 213 GA17076-PA 8..191 7..186 386 42.5 Plus
Dpse\GA18527-PA 213 GA18527-PA 6..177 3..169 359 44.5 Plus
Dpse\GA17598-PA 218 GA17598-PA 30..201 7..177 352 41.6 Plus
Dpse\GA26078-PA 204 GA26078-PA 7..171 3..166 340 41.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:00:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12630-PA 197 GM12630-PA 1..197 1..197 1009 98 Plus
Dsec\GM20894-PA 200 GM20894-PA 8..171 7..165 381 45.5 Plus
Dsec\GM21805-PA 213 GM21805-PA 6..177 3..169 359 44.5 Plus
Dsec\GM18235-PA 219 GM18235-PA 31..202 7..177 352 41.6 Plus
Dsec\GM23016-PA 204 GM23016-PA 7..171 3..166 338 41.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:00:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16245-PA 197 GD16245-PA 1..197 1..197 1012 98.5 Plus
Dsim\GD10420-PA 213 GD10420-PA 8..191 7..186 386 42.5 Plus
Dsim\GD11294-PA 213 GD11294-PA 6..177 3..169 359 44.5 Plus
Dsim\GD22841-PA 219 GD22841-PA 31..202 7..177 352 41.6 Plus
Dsim\GD14074-PA 219 GD14074-PA 19..216 3..195 334 37.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:00:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16685-PA 197 GJ16685-PA 1..197 1..197 925 87.8 Plus
Dvir\GJ22175-PA 213 GJ22175-PA 8..190 7..185 386 42.7 Plus
Dvir\GJ21435-PA 213 GJ21435-PA 6..177 3..169 354 43.9 Plus
Dvir\GJ22226-PA 216 GJ22226-PA 30..189 7..165 345 42.9 Plus
Dvir\GJ18220-PA 225 GJ18220-PA 9..178 7..176 343 39.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:00:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21207-PA 199 GK21207-PA 1..199 1..197 909 86.9 Plus
Dwil\GK19906-PA 199 GK19906-PA 1..199 1..197 909 86.9 Plus
Dwil\GK23088-PA 213 GK23088-PA 8..191 7..186 386 42.5 Plus
Dwil\GK10719-PA 213 GK10719-PA 6..177 3..169 360 44.5 Plus
Dwil\GK14984-PA 220 GK14984-PA 31..202 7..177 351 41.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:00:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16798-PA 197 GE16798-PA 1..197 1..197 981 93.9 Plus
Dyak\GE19072-PA 213 GE19072-PA 8..191 7..186 386 42.5 Plus
Dyak\GE11879-PA 213 GE11879-PA 6..177 3..169 359 44.5 Plus
Dyak\GE15124-PA 219 GE15124-PA 31..202 7..177 352 41.6 Plus
Dyak\GE17866-PA 204 GE17866-PA 7..171 3..166 338 41.6 Plus

GH11193.hyp Sequence

Translation from 106 to 699

> GH11193.hyp
MADRAIKLLVIGESGVGKSSLIRRFVENKFDQNHDVTIGMDFKSKVMQVD
GIDYKVALWDTAGAERFRSLTPSFYRKALGAILVYDITSRDSLVKLETWL
AELDSYSDNPNIAIIVVGNKIDEERVVDREEGRKFARKHRALFIETSAKC
DQFVSDVFKDVVEKIVSSEYFNNGNASAGLDIASDRDLEASASTCYC*

GH11193.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:59:24
Subject Length Description Subject Range Query Range Score Percent Strand
Rab18-PA 197 CG3129-PA 1..197 1..197 998 100 Plus
Rab2-PB 213 CG3269-PB 8..183 7..177 379 43.5 Plus
Rab2-PA 213 CG3269-PA 8..183 7..177 379 43.5 Plus
Rab4-PA 213 CG4921-PA 6..177 3..169 354 44.5 Plus
Rab4-PB 213 CG4921-PB 6..177 3..169 354 44.5 Plus