Clone GH11417 Report

Search the DGRC for GH11417

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:114
Well:17
Vector:pOT2
Associated Gene/TranscriptBace-RA
Protein status:GH11417.pep: gold
Preliminary Size:1300
Sequenced Size:1209

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13095 2001-01-01 Release 2 assignment
CG13095 2003-01-01 Sim4 clustering to Release 3
CG13095 2004-10-22 Blastp of sequenced clone
CG13095 2008-04-29 Release 5.5 accounting
CG13095 2008-08-15 Release 5.9 accounting
CG13095 2008-12-18 5.12 accounting

Clone Sequence Records

GH11417.complete Sequence

1209 bp (1209 high quality bases) assembled on 2004-10-22

GenBank Submission: BT016133

> GH11417.complete
AGTAGACTAGAAACCAAGAGAATGTTCAAGACCATCGCTGTAGTAGTGCT
CCTGGCAGCCCTGGCCAGTGCCGAGCTCCATCGCGTGCCGATCCTCAAGG
AGCAGAACTTTGTGAAGACGCGTCAGAATGTTTTGGCCGAGAAATCCTAT
CTGCGCACCAAGTACCAGCTGCCCTCGCTTCGCAGCGTGGATGAGGAACA
GCTGTCCAACTCGATGAATATGGCTTACTACGGAGCCATCTCCATCGGAA
CTCCCGCTCAGAGCTTCAAGGTTCTGTTCGACTCAGGCTCCTCGAACCTG
TGGGTGCCATCGAACACCTGCAAGAGCGATGCCTGCCTGACCCACAACCA
GTACGACTCCAGCGCCAGCTCCACCTACGTGGCCAACGGCGAATCCTTCT
CCATCCAGTATGGCACTGGCAGCCTAACTGGCTACCTGTCCACCGATACC
GTCGACGTCAATGGCCTGAGCATCCAGAGCCAGACCTTTGCTGAATCCAC
CAACGAGCCGGGCACCAACTTCAACGATGCCAACTTCGATGGCATTCTCG
GTATGGCCTATGAGTCCCTGGCCGTGGATGGTGTGGCTCCTCCGTTCTAC
AACATGGTGTCCCAGGGTCTGGTCGACAACTCCGTCTTCTCGTTCTATCT
GGCCCGCGATGGCACCTCCACTATGGGTGGTGAACTCATCTTCGGTGGCT
CCGATGCCTCTCTGTACTCTGGCGCTCTGACCTACGTTCCCATCTCGGAG
CAGGGCTACTGGCAGTTCACCATGGCTGGATCCTCCATTGACGGTTACTC
GCTGTGTGATGATTGCCAGGCTATTGCCGATACCGGCACCTCCCTGATCG
TGGCTCCCTACAATGCTTACATTACCCTCTCCGAGATCCTGAACGTGGGT
GAGGATGGCTATCTGGACTGCTCAAGCGTCAGCTCCCTGCCCGATGTCAC
CTTCAACATCGGTGGCACCAACTTCGTCCTGAAGCCCTCGGCCTACATCA
TCCAGTCGGACGGCAACTGTATGTCCGCCTTCGAGTACATGGGCACCGAC
TTCTGGATTCTGGGCGATGTCTTCATTGGCCAGTACTACACCGAGTTCGA
TTTGGGCAACAACCGCATTGGCTTCGCCCCAGTCGCCTAATTAACGATCC
GCAATTACGAATCAATAAAGAAACGAGCTCTTAAAAAAAAAAAAAAAAAA
AAAAAAAAA

GH11417.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:56:35
Subject Length Description Subject Range Query Range Score Percent Strand
Bace-RA 1197 Bace-RA 16..1197 1..1182 5910 100 Plus
CG33128-RA 1367 CG33128-RA 456..601 343..488 205 76 Plus
CG33128-RA 1367 CG33128-RA 1055..1121 933..999 170 83.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:41:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8494024..8495205 1182..1 5895 99.9 Minus
chr2L 23010047 chr2L 1494470..1494615 343..488 205 76 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:44:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:41:33
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8495107..8496289 1183..1 5915 100 Minus
2L 23513712 2L 1494545..1494690 343..488 205 76 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:45:20
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8495107..8496289 1183..1 5915 100 Minus
2L 23513712 2L 1494545..1494690 343..488 205 76 Plus
2L 23513712 2L 1495144..1495210 933..999 170 83.5 Plus
Blast to na_te.dros performed on 2019-03-16 08:41:33 has no hits.

GH11417.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:42:15 Download gff for GH11417.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8494024..8495205 1..1182 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:35:30 Download gff for GH11417.complete
Subject Subject Range Query Range Percent Splice Strand
CG13095-RA 1..1119 22..1140 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:30:06 Download gff for GH11417.complete
Subject Subject Range Query Range Percent Splice Strand
Bace-RA 1..1119 22..1140 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:52:37 Download gff for GH11417.complete
Subject Subject Range Query Range Percent Splice Strand
Bace-RA 1..1119 22..1140 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:14:00 Download gff for GH11417.complete
Subject Subject Range Query Range Percent Splice Strand
CG13095-RA 1..1119 22..1140 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:46:41 Download gff for GH11417.complete
Subject Subject Range Query Range Percent Splice Strand
Bace-RA 1..1119 22..1140 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:34:23 Download gff for GH11417.complete
Subject Subject Range Query Range Percent Splice Strand
CG13095-RA 16..1197 1..1182 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:30:06 Download gff for GH11417.complete
Subject Subject Range Query Range Percent Splice Strand
Bace-RA 16..1197 1..1182 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:52:37 Download gff for GH11417.complete
Subject Subject Range Query Range Percent Splice Strand
Bace-RA 19..1200 1..1182 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:14:00 Download gff for GH11417.complete
Subject Subject Range Query Range Percent Splice Strand
CG13095-RA 16..1197 1..1182 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:46:41 Download gff for GH11417.complete
Subject Subject Range Query Range Percent Splice Strand
Bace-RA 19..1200 1..1182 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:42:15 Download gff for GH11417.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8495108..8496289 1..1182 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:42:15 Download gff for GH11417.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8495108..8496289 1..1182 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:42:15 Download gff for GH11417.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8495108..8496289 1..1182 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:52:37 Download gff for GH11417.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8495108..8496289 1..1182 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:50:46 Download gff for GH11417.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8495108..8496289 1..1182 100   Minus

GH11417.hyp Sequence

Translation from 1 to 1139

> GH11417.hyp
SRLETKRMFKTIAVVVLLAALASAELHRVPILKEQNFVKTRQNVLAEKSY
LRTKYQLPSLRSVDEEQLSNSMNMAYYGAISIGTPAQSFKVLFDSGSSNL
WVPSNTCKSDACLTHNQYDSSASSTYVANGESFSIQYGTGSLTGYLSTDT
VDVNGLSIQSQTFAESTNEPGTNFNDANFDGILGMAYESLAVDGVAPPFY
NMVSQGLVDNSVFSFYLARDGTSTMGGELIFGGSDASLYSGALTYVPISE
QGYWQFTMAGSSIDGYSLCDDCQAIADTGTSLIVAPYNAYITLSEILNVG
EDGYLDCSSVSSLPDVTFNIGGTNFVLKPSAYIIQSDGNCMSAFEYMGTD
FWILGDVFIGQYYTEFDLGNNRIGFAPVA*

GH11417.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:21:42
Subject Length Description Subject Range Query Range Score Percent Strand
Bace-PB 372 CG13095-PB 1..372 8..379 1923 100 Plus
Bace-PA 372 CG13095-PA 1..372 8..379 1923 100 Plus
CG33128-PA 405 CG33128-PA 6..405 14..379 1034 52 Plus
CG17134-PA 391 CG17134-PA 2..389 10..379 1023 54.4 Plus
pcl-PA 407 CG13374-PA 12..379 12..378 959 51.8 Plus

GH11417.pep Sequence

Translation from 21 to 1139

> GH11417.pep
MFKTIAVVVLLAALASAELHRVPILKEQNFVKTRQNVLAEKSYLRTKYQL
PSLRSVDEEQLSNSMNMAYYGAISIGTPAQSFKVLFDSGSSNLWVPSNTC
KSDACLTHNQYDSSASSTYVANGESFSIQYGTGSLTGYLSTDTVDVNGLS
IQSQTFAESTNEPGTNFNDANFDGILGMAYESLAVDGVAPPFYNMVSQGL
VDNSVFSFYLARDGTSTMGGELIFGGSDASLYSGALTYVPISEQGYWQFT
MAGSSIDGYSLCDDCQAIADTGTSLIVAPYNAYITLSEILNVGEDGYLDC
SSVSSLPDVTFNIGGTNFVLKPSAYIIQSDGNCMSAFEYMGTDFWILGDV
FIGQYYTEFDLGNNRIGFAPVA*

GH11417.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:42:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14369-PA 371 GF14369-PA 1..371 1..372 1774 89.2 Plus
Dana\GF19728-PA 390 GF19728-PA 7..389 5..372 981 51.7 Plus
Dana\GF15184-PA 403 GF15184-PA 15..403 16..372 966 50.9 Plus
Dana\GF20814-PA 405 GF20814-PA 25..379 19..371 909 51 Plus
Dana\GF19727-PA 449 GF19727-PA 5..380 7..371 903 50.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:42:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24067-PA 372 GG24067-PA 1..372 1..372 1810 94.9 Plus
Dere\GG23678-PA 392 GG23678-PA 16..390 15..372 1058 56 Plus
Dere\GG24793-PA 404 GG24793-PA 1..404 1..372 1011 50.9 Plus
Dere\GG12763-PA 407 GG12763-PA 8..379 1..371 953 50.4 Plus
Dere\GG23677-PA 427 GG23677-PA 21..387 17..371 925 50.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:42:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24623-PA 374 GH24623-PA 1..374 1..372 1541 77.5 Plus
Dgri\GH24344-PA 373 GH24344-PA 15..373 16..372 1391 73.6 Plus
Dgri\GH11416-PA 400 GH11416-PA 1..398 1..370 1018 53.1 Plus
Dgri\GH24624-PA 446 GH24624-PA 31..387 18..371 1012 52 Plus
Dgri\GH21578-PA 388 GH21578-PA 15..385 13..369 869 47.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:18:34
Subject Length Description Subject Range Query Range Score Percent Strand
Bace-PB 372 CG13095-PB 1..372 1..372 1923 100 Plus
Bace-PA 372 CG13095-PA 1..372 1..372 1923 100 Plus
CG33128-PA 405 CG33128-PA 6..405 7..372 1034 52 Plus
CG17134-PA 391 CG17134-PA 2..389 3..372 1023 54.4 Plus
Pgcl-PA 407 CG13374-PA 12..379 5..371 959 51.8 Plus
CG6508-PA 423 CG6508-PA 9..385 5..369 930 50.8 Plus
CG5863-PA 395 CG5863-PA 7..395 1..372 857 45.5 Plus
cathD-PC 392 CG1548-PC 6..389 8..369 853 47.4 Plus
cathD-PB 392 CG1548-PB 6..389 8..369 853 47.4 Plus
cathD-PA 392 CG1548-PA 6..389 8..369 853 47.4 Plus
CG31926-PB 410 CG31926-PB 15..407 5..370 767 42.4 Plus
CG31926-PA 410 CG31926-PA 15..407 5..370 767 42.4 Plus
CG10104-PA 404 CG10104-PA 27..400 18..369 745 43.2 Plus
CG17283-PA 465 CG17283-PA 103..459 22..369 741 43.4 Plus
CG31928-PB 418 CG31928-PB 78..416 55..370 657 41.9 Plus
CG31928-PA 418 CG31928-PA 78..416 55..370 657 41.9 Plus
CG5860-PA 370 CG5860-PA 56..367 61..369 545 38.1 Plus
CG31661-PA 393 CG31661-PA 46..391 41..370 519 36 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:42:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11125-PA 371 GI11125-PA 1..371 1..372 1563 78 Plus
Dmoj\GI11124-PA 373 GI11124-PA 1..373 1..372 1474 73.5 Plus
Dmoj\GI14567-PA 402 GI14567-PA 13..402 11..372 1055 55 Plus
Dmoj\GI11126-PA 421 GI11126-PA 18..385 17..372 1012 52.2 Plus
Dmoj\GI19550-PA 387 GI19550-PA 21..384 18..369 835 50 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:42:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25647-PA 373 GL25647-PA 2..373 1..372 1724 86 Plus
Dper\GL26637-PA 387 GL26637-PA 1..385 1..372 1062 56.1 Plus
Dper\GL15694-PA 401 GL15694-PA 1..400 1..372 1060 52.7 Plus
Dper\GL23572-PA 393 GL23572-PA 19..393 14..372 897 47.5 Plus
Dper\GL11239-PA 388 GL11239-PA 19..385 15..369 885 48.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:42:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22213-PA 373 GA22213-PA 2..373 1..372 1729 86.3 Plus
Dpse\GA25369-PA 373 GA25369-PA 2..373 1..372 1724 86 Plus
Dpse\GA14340-PA 387 GA14340-PA 1..385 1..372 1077 56.1 Plus
Dpse\GA17303-PA 401 GA17303-PA 1..400 1..372 1053 52.5 Plus
Dpse\GA22674-PA 423 GA22674-PA 27..392 17..371 1005 52.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:42:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12869-PA 372 GM12869-PA 1..372 1..372 1924 98.4 Plus
Dsec\GM18746-PA 392 GM18746-PA 18..390 17..372 1050 56.8 Plus
Dsec\GM16820-PA 405 GM16820-PA 1..405 1..372 997 51.2 Plus
Dsec\GM19043-PA 407 GM19043-PA 12..379 5..371 938 51.2 Plus
Dsec\GM15229-PA 395 GM15229-PA 7..395 1..372 897 45.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:42:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23099-PA 405 GD23099-PA 1..405 1..372 1004 51.7 Plus
Dsim\GD23735-PA 404 GD23735-PA 2..368 17..371 925 50 Plus
Dsim\GD23736-PA 564 GD23736-PA 261..562 82..372 913 58.9 Plus
Dsim\GD19155-PA 395 GD19155-PA 7..395 1..372 896 45.5 Plus
Dsim\GD10217-PA 324 GD10217-PA 1..321 65..369 833 51.1 Plus
Dsim\GD23736-PA 564 GD23736-PA 16..259 15..250 729 58.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:42:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15983-PA 372 GJ15983-PA 1..372 1..372 1625 81.2 Plus
Dvir\GJ15982-PA 374 GJ15982-PA 1..374 1..372 1520 76.5 Plus
Dvir\GJ15984-PA 423 GJ15984-PA 9..386 4..371 1074 53.7 Plus
Dvir\GJ17077-PA 404 GJ17077-PA 1..404 1..372 1051 53.1 Plus
Dvir\GJ21122-PA 391 GJ21122-PA 10..388 5..369 839 48 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:42:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24836-PA 372 GK24836-PA 1..372 1..372 1715 85.2 Plus
Dwil\GK19045-PA 411 GK19045-PA 1..411 1..372 1049 52.5 Plus
Dwil\GK25659-PA 406 GK25659-PA 9..392 3..372 998 55.8 Plus
Dwil\GK11645-PA 388 GK11645-PA 1..388 1..372 916 46.1 Plus
Dwil\GK21682-PA 389 GK21682-PA 10..386 5..369 904 49.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:42:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10927-PA 372 GE10927-PA 1..372 1..372 1802 94.1 Plus
Dyak\GE18491-PA 392 GE18491-PA 16..390 15..372 1057 57.1 Plus
Dyak\GE17593-PA 404 GE17593-PA 1..404 1..372 994 51.6 Plus
Dyak\GE16588-PA 408 GE16588-PA 12..380 5..371 964 51.5 Plus
Dyak\GE10129-PA 396 GE10129-PA 19..396 13..372 884 46.8 Plus