Clone GH11579 Report

Search the DGRC for GH11579

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:115
Well:79
Vector:pOT2
Associated Gene/TranscriptIlp2-RA
Protein status:GH11579.pep: gold
Preliminary Size:801
Sequenced Size:691

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8167 2001-11-29 Blastp of sequenced clone
CG8167 2003-01-01 Sim4 clustering to Release 3
Ilp2 2008-04-29 Release 5.5 accounting
Ilp2 2008-08-15 Release 5.9 accounting
Ilp2 2008-12-18 5.12 accounting

Clone Sequence Records

GH11579.complete Sequence

691 bp (691 high quality bases) assembled on 2001-11-29

GenBank Submission: AY069095

> GH11579.complete
TCGACCCGGCTCGACCCAACTTAATCCATTTGATCGTAAAGCAACCTAAG
CAGTAAACCCATAACCATGAGCAAGCCTTTGTCCTTCATCTCGATGGTGG
CCGTGATTTTGCTGGCCAGCTCCACAGTGAAGTTGGCCCAAGGAACGCTC
TGCAGTGAAAAGCTCAACGAGGTGCTGAGTATGGTGTGCGAGGAGTATAA
TCCCGTGATTCCACACAAGCGCGCCATGCCCGGTGCCGACAGCGATCTGG
ACGCCCTCAATCCCCTGCAGTTTGTCCAGGAGTTCGAGGAGGAGGATAAC
TCGATATCGGAACCGCTGCGAAGTGCCCTCTTTCCTGGGAGCTATCTTGG
GGGTGTACTCAATTCCCTGGCTGAAGTCCGGAGGCGAACTCGCCAACGGC
AAGGAATCGTGGAGAGGTGCTGCAAAAAGTCCTGTGATATGAAGGCTCTG
CGGGAGTACTGCTCCGTGGTCAGAAATTAGGCCTCCTAATGCGAAAATCA
TTGACCCCAACTGACCTGGTCGACGCGATTATCTCTGGATCTGGTTCCAA
ACCAACCATGTGCATATATACTACAATCGATGTTTTTTACAGCTTGTTGC
ATGTTACTCTTTACGAATGATCGAAATGGATTAAATATATATTCTGCTTT
AAGCTTTGGCAAACAATCGCAAAAAAAAAAAAAAAAAAAAA

GH11579.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:56:00
Subject Length Description Subject Range Query Range Score Percent Strand
Ilp2-RA 787 Ilp2-RA 4..676 1..673 3365 100 Plus
Ilp2.a 874 Ilp2.a 176..848 1..673 3365 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:44:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 9791762..9792202 230..670 2160 99.3 Plus
chr3L 24539361 chr3L 9791460..9791688 1..229 1145 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:44:43 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:44:43
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9800000..9800443 230..673 2220 100 Plus
3L 28110227 3L 9799698..9799926 1..229 1145 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:21:22
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 9793100..9793543 230..673 2220 100 Plus
3L 28103327 3L 9792798..9793026 1..229 1145 100 Plus
Blast to na_te.dros performed 2019-03-15 21:44:43
Subject Length Description Subject Range Query Range Score Percent Strand
diver2 4917 diver2 DIVER2 4917bp 4108..4145 243..280 109 76.3 Plus

GH11579.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:45:24 Download gff for GH11579.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 9791460..9791688 1..229 100 -> Plus
chr3L 9791762..9792202 230..670 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:35:45 Download gff for GH11579.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp2-RA 1..414 67..480 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:27:26 Download gff for GH11579.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp2-RA 1..414 67..480 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:57:26 Download gff for GH11579.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp2-RA 1..414 67..480 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:55:00 Download gff for GH11579.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp2-RA 1..414 67..480 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:02:14 Download gff for GH11579.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp2-RA 1..414 67..480 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:04:16 Download gff for GH11579.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp2-RA 1..670 1..670 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:27:26 Download gff for GH11579.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp2-RA 1..670 1..670 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:57:26 Download gff for GH11579.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp2-RA 1..670 1..670 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:55:01 Download gff for GH11579.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp2-RA 1..670 1..670 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:02:14 Download gff for GH11579.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp2-RA 1..670 1..670 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:45:24 Download gff for GH11579.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9799698..9799926 1..229 100 -> Plus
3L 9800000..9800440 230..670 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:45:24 Download gff for GH11579.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9799698..9799926 1..229 100 -> Plus
3L 9800000..9800440 230..670 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:45:24 Download gff for GH11579.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9799698..9799926 1..229 100 -> Plus
3L 9800000..9800440 230..670 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:57:26 Download gff for GH11579.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9792798..9793026 1..229 100 -> Plus
arm_3L 9793100..9793540 230..670 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:31:02 Download gff for GH11579.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9792798..9793026 1..229 100 -> Plus
3L 9793100..9793540 230..670 100   Plus

GH11579.hyp Sequence

Translation from 66 to 479

> GH11579.hyp
MSKPLSFISMVAVILLASSTVKLAQGTLCSEKLNEVLSMVCEEYNPVIPH
KRAMPGADSDLDALNPLQFVQEFEEEDNSISEPLRSALFPGSYLGGVLNS
LAEVRRRTRQRQGIVERCCKKSCDMKALREYCSVVRN*

GH11579.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:22:51
Subject Length Description Subject Range Query Range Score Percent Strand
Ilp2-PA 137 CG8167-PA 1..137 1..137 696 100 Plus

GH11579.pep Sequence

Translation from 66 to 479

> GH11579.pep
MSKPLSFISMVAVILLASSTVKLAQGTLCSEKLNEVLSMVCEEYNPVIPH
KRAMPGADSDLDALNPLQFVQEFEEEDNSISEPLRSALFPGSYLGGVLNS
LAEVRRRTRQRQGIVERCCKKSCDMKALREYCSVVRN*

GH11579.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 10:24:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24678-PA 137 GF24678-PA 31..135 29..134 245 46.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 10:24:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15413-PA 137 GG15413-PA 1..137 1..137 655 91.2 Plus
Dere\GG19126-PA 137 GG19126-PA 1..137 1..137 655 91.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 10:24:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15432-PA 133 GH15432-PA 29..132 28..133 203 43.1 Plus
Dgri\GH15434-PA 133 GH15434-PA 29..132 28..133 160 40.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:59:23
Subject Length Description Subject Range Query Range Score Percent Strand
Ilp2-PA 137 CG8167-PA 1..137 1..137 696 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 10:24:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13035-PA 135 GI13035-PA 30..135 28..134 202 43.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:24:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20861-PA 173 GA20861-PA 67..170 27..134 289 53.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 10:24:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25186-PA 137 GM25186-PA 1..137 1..137 702 97.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 10:24:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14218-PA 137 GD14218-PA 1..137 1..137 702 97.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 10:24:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12130-PA 135 GJ12130-PA 5..135 1..134 204 36.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 10:24:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10990-PA 151 GK10990-PA 1..149 1..134 208 42.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 10:24:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21720-PA 137 GE21720-PA 1..137 1..137 690 94.2 Plus