BDGP Sequence Production Resources |
Search the DGRC for GH11579
Library: | GH |
Tissue Source: | Drosophila melanogaster head |
Created by: | Ling Hong |
Date Registered: | 1998-06-02 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 115 |
Well: | 79 |
Vector: | pOT2 |
Associated Gene/Transcript | Ilp2-RA |
Protein status: | GH11579.pep: gold |
Preliminary Size: | 801 |
Sequenced Size: | 691 |
Gene | Date | Evidence |
---|---|---|
CG8167 | 2001-11-29 | Blastp of sequenced clone |
CG8167 | 2003-01-01 | Sim4 clustering to Release 3 |
Ilp2 | 2008-04-29 | Release 5.5 accounting |
Ilp2 | 2008-08-15 | Release 5.9 accounting |
Ilp2 | 2008-12-18 | 5.12 accounting |
691 bp (691 high quality bases) assembled on 2001-11-29
GenBank Submission: AY069095
> GH11579.complete TCGACCCGGCTCGACCCAACTTAATCCATTTGATCGTAAAGCAACCTAAG CAGTAAACCCATAACCATGAGCAAGCCTTTGTCCTTCATCTCGATGGTGG CCGTGATTTTGCTGGCCAGCTCCACAGTGAAGTTGGCCCAAGGAACGCTC TGCAGTGAAAAGCTCAACGAGGTGCTGAGTATGGTGTGCGAGGAGTATAA TCCCGTGATTCCACACAAGCGCGCCATGCCCGGTGCCGACAGCGATCTGG ACGCCCTCAATCCCCTGCAGTTTGTCCAGGAGTTCGAGGAGGAGGATAAC TCGATATCGGAACCGCTGCGAAGTGCCCTCTTTCCTGGGAGCTATCTTGG GGGTGTACTCAATTCCCTGGCTGAAGTCCGGAGGCGAACTCGCCAACGGC AAGGAATCGTGGAGAGGTGCTGCAAAAAGTCCTGTGATATGAAGGCTCTG CGGGAGTACTGCTCCGTGGTCAGAAATTAGGCCTCCTAATGCGAAAATCA TTGACCCCAACTGACCTGGTCGACGCGATTATCTCTGGATCTGGTTCCAA ACCAACCATGTGCATATATACTACAATCGATGTTTTTTACAGCTTGTTGC ATGTTACTCTTTACGAATGATCGAAATGGATTAAATATATATTCTGCTTT AAGCTTTGGCAAACAATCGCAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
diver2 | 4917 | diver2 DIVER2 4917bp | 4108..4145 | 243..280 | 109 | 76.3 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 9791460..9791688 | 1..229 | 100 | -> | Plus |
chr3L | 9791762..9792202 | 230..670 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ilp2-RA | 1..414 | 67..480 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ilp2-RA | 1..414 | 67..480 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ilp2-RA | 1..414 | 67..480 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ilp2-RA | 1..414 | 67..480 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ilp2-RA | 1..414 | 67..480 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ilp2-RA | 1..670 | 1..670 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ilp2-RA | 1..670 | 1..670 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ilp2-RA | 1..670 | 1..670 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ilp2-RA | 1..670 | 1..670 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Ilp2-RA | 1..670 | 1..670 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 9799698..9799926 | 1..229 | 100 | -> | Plus |
3L | 9800000..9800440 | 230..670 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 9799698..9799926 | 1..229 | 100 | -> | Plus |
3L | 9800000..9800440 | 230..670 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 9799698..9799926 | 1..229 | 100 | -> | Plus |
3L | 9800000..9800440 | 230..670 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 9792798..9793026 | 1..229 | 100 | -> | Plus |
arm_3L | 9793100..9793540 | 230..670 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 9792798..9793026 | 1..229 | 100 | -> | Plus |
3L | 9793100..9793540 | 230..670 | 100 | Plus |
Translation from 66 to 479
> GH11579.hyp MSKPLSFISMVAVILLASSTVKLAQGTLCSEKLNEVLSMVCEEYNPVIPH KRAMPGADSDLDALNPLQFVQEFEEEDNSISEPLRSALFPGSYLGGVLNS LAEVRRRTRQRQGIVERCCKKSCDMKALREYCSVVRN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Ilp2-PA | 137 | CG8167-PA | 1..137 | 1..137 | 696 | 100 | Plus |
Translation from 66 to 479
> GH11579.pep MSKPLSFISMVAVILLASSTVKLAQGTLCSEKLNEVLSMVCEEYNPVIPH KRAMPGADSDLDALNPLQFVQEFEEEDNSISEPLRSALFPGSYLGGVLNS LAEVRRRTRQRQGIVERCCKKSCDMKALREYCSVVRN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24678-PA | 137 | GF24678-PA | 31..135 | 29..134 | 245 | 46.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15413-PA | 137 | GG15413-PA | 1..137 | 1..137 | 655 | 91.2 | Plus |
Dere\GG19126-PA | 137 | GG19126-PA | 1..137 | 1..137 | 655 | 91.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15432-PA | 133 | GH15432-PA | 29..132 | 28..133 | 203 | 43.1 | Plus |
Dgri\GH15434-PA | 133 | GH15434-PA | 29..132 | 28..133 | 160 | 40.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Ilp2-PA | 137 | CG8167-PA | 1..137 | 1..137 | 696 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI13035-PA | 135 | GI13035-PA | 30..135 | 28..134 | 202 | 43.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA20861-PA | 173 | GA20861-PA | 67..170 | 27..134 | 289 | 53.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25186-PA | 137 | GM25186-PA | 1..137 | 1..137 | 702 | 97.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14218-PA | 137 | GD14218-PA | 1..137 | 1..137 | 702 | 97.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ12130-PA | 135 | GJ12130-PA | 5..135 | 1..134 | 204 | 36.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK10990-PA | 151 | GK10990-PA | 1..149 | 1..134 | 208 | 42.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE21720-PA | 137 | GE21720-PA | 1..137 | 1..137 | 690 | 94.2 | Plus |