Clone GH11671 Report

Search the DGRC for GH11671

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:116
Well:71
Vector:pOT2
Associated Gene/TranscriptCbp53E-RA
Protein status:GH11671.pep: gold
Preliminary Size:1444
Sequenced Size:1339

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6702 2001-01-01 Release 2 assignment
CG6702 2001-09-19 Blastp of sequenced clone
CG6702 2003-01-01 Sim4 clustering to Release 3
Cbp53E 2008-04-29 Release 5.5 accounting
Cbp53E 2008-08-15 Release 5.9 accounting
Cbp53E 2008-12-18 5.12 accounting

Clone Sequence Records

GH11671.complete Sequence

1339 bp (1339 high quality bases) assembled on 2001-09-19

GenBank Submission: AY058340

> GH11671.complete
TTCTCCAAAGATAAAATACCGTCAAGTATTAGGCAACGGCAATCGTCGCG
TGCGTTTTAACCAAATATACTTAAAATCGAAAATTACCTGGAAAAACGGT
CGAGAAAAGTGAATTTTAGTTTTTGGAAAAGAAGAAATTCCAAAAGCAAG
CAGCAGTTTTAAAAAAGATAATTGCTCAGCAGCATCTAGTTTCTCAGCGA
GGACAAATAAACCCGAGAACAAAAAAAAAAACATAAGAAATGGACTCTGC
CGCCGCCGCCGCCGCCAAGCGCGTTCAAATCGAGAAGGCCCACAACTTTA
TGCGCCAGTATCGTGATCCCGAGTCCAGGGAACTCAAGAAGCTGTCGGCC
AACCAGTTCATGGATGTCTGGGCGCATTACGATAAAGATGGAAATGGCTA
CATTGAGGGCACCGAGCTGGACGGATTCCTGCGGGAGTTCGTGTCGAGTG
CCAATGCCACAGACATTAGTCCAGAGGCAGTAACGGACACCATGCTCGAG
GAGCTAAAGTCCTGCTTCATGGAGGCCTACGATGACAATCAGGATGGTAA
AATCGATATCAGAGAGCTGGCTCAACTTTTGCCCATGGAGGAGAATTTCC
TTTTGCTCTTCCGCTTCGATAATCCTCTGGAATCTAGCGTTGAATTCATG
AAGATCTGGCGTGAATACGACACCGACAATTCGGGTTACATTGAAGCGGA
TGAGCTGAAAAATTTCTTGCGCGATTTGCTCAAAGAGGCCAAAAAGATCA
ACGACGTGTCCGAGGACAAGCTCATTGAGTACACCGATACTATGCTCCAA
GTATTCGATGCCAACAAGGACGGACGTCTGCAGTTGTCGGAAATGGCCAA
ATTGCTTCCGGTTAAAGAGAACTTCCTGTGCCGCCAAGTGTTTAAGGGCG
CCACAAAGTTGACCAAAGAGGATATTGAAAAAGTATTCTCACTCTACGAT
CGTGACAATAGCGGCACCATTGAAAATGAGGAGCTCAAAGGCTTCTTGAA
GGACCTTTTGGAGTTGGTCAAGAAGGACGACTATGATGCCCAGGATCTGG
CCGCTTTCGAGGAGACCATCATGCGGGGAGTTGGCACCGACAAGCATGGA
AAGATCTCCCGGAAAGAACTGACCATGATTCTGCTAACACTGGCCAAAAT
ATCGCCCGACGACGAGGAGTAAGCCGGATGTTCGAGAACATACCAAAAAG
AGATTTTAGCCAACTCTATTTTTGTCACCCGAACGCGGGAAATCCAGAAA
TGAGGCCAAAATGGGCTTCAAGGCAATTGTTTACTTTAGAGCTGCATTAA
AAGGGGCAGCAAATAAACAAAAAAAAAAAAAAAAAAAAA

GH11671.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:23:26
Subject Length Description Subject Range Query Range Score Percent Strand
Cbp53E-RA 2718 Cbp53E-RA 43..1372 1..1330 6635 99.9 Plus
Cbp53E.a 2792 Cbp53E.a 281..1446 165..1330 5815 99.9 Plus
Cbp53E.a 2792 Cbp53E.a 68..233 1..166 830 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:19:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 12881638..12881932 1024..1318 1475 100 Plus
chr2R 21145070 chr2R 12871511..12871736 166..391 1100 99.1 Plus
chr2R 21145070 chr2R 12861192..12861356 1..165 825 100 Plus
chr2R 21145070 chr2R 12873315..12873457 652..794 715 100 Plus
chr2R 21145070 chr2R 12873163..12873251 565..653 445 100 Plus
chr2R 21145070 chr2R 12871943..12872030 390..477 440 100 Plus
chr2R 21145070 chr2R 12872085..12872180 475..570 435 96.9 Plus
chr2R 21145070 chr2R 12881511..12881583 954..1026 365 100 Plus
chr2R 21145070 chr2R 12881387..12881446 895..954 300 100 Plus
chr2R 21145070 chr2R 12873826..12873882 794..850 285 100 Plus
chr2R 21145070 chr2R 12873951..12873997 851..897 235 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:44:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:18:58
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16994409..16994715 1024..1330 1520 99.7 Plus
2R 25286936 2R 16984266..16984491 166..391 1130 100 Plus
2R 25286936 2R 16973960..16974124 1..165 825 100 Plus
2R 25286936 2R 16986069..16986211 652..794 715 100 Plus
2R 25286936 2R 16984840..16984935 475..570 465 99 Plus
2R 25286936 2R 16985917..16986005 565..653 445 100 Plus
2R 25286936 2R 16984698..16984785 390..477 440 100 Plus
2R 25286936 2R 16994282..16994354 954..1026 365 100 Plus
2R 25286936 2R 16994158..16994217 895..954 300 100 Plus
2R 25286936 2R 16986580..16986636 794..850 285 100 Plus
2R 25286936 2R 16986705..16986751 851..897 235 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:46:13
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 16995608..16995914 1024..1330 1520 99.6 Plus
2R 25260384 2R 16985465..16985690 166..391 1130 100 Plus
2R 25260384 2R 16975159..16975323 1..165 825 100 Plus
2R 25260384 2R 16987268..16987410 652..794 715 100 Plus
2R 25260384 2R 16986039..16986134 475..570 465 98.9 Plus
2R 25260384 2R 16987116..16987204 565..653 445 100 Plus
2R 25260384 2R 16985897..16985984 390..477 440 100 Plus
2R 25260384 2R 16995481..16995553 954..1026 365 100 Plus
2R 25260384 2R 16995357..16995416 895..954 300 100 Plus
2R 25260384 2R 16987779..16987835 794..850 285 100 Plus
2R 25260384 2R 16987904..16987950 851..897 235 100 Plus
Blast to na_te.dros performed on 2019-03-15 15:18:59 has no hits.

GH11671.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:19:41 Download gff for GH11671.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12861192..12861356 1..165 100 -> Plus
chr2R 12871511..12871735 166..390 99 -> Plus
chr2R 12871944..12872029 391..476 100 -> Plus
chr2R 12872087..12872176 477..566 97 -> Plus
chr2R 12873165..12873251 567..653 100 -> Plus
chr2R 12873317..12873457 654..794 100 -> Plus
chr2R 12873827..12873882 795..850 100 -> Plus
chr2R 12873951..12873996 851..896 100 -> Plus
chr2R 12881389..12881445 897..953 100 -> Plus
chr2R 12881511..12881582 954..1025 100 -> Plus
chr2R 12881640..12881932 1026..1318 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:23:03 Download gff for GH11671.complete
Subject Subject Range Query Range Percent Splice Strand
Cbp53E-RA 1..933 240..1172 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:08:24 Download gff for GH11671.complete
Subject Subject Range Query Range Percent Splice Strand
Cbp53E-RA 1..933 240..1172 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:23:50 Download gff for GH11671.complete
Subject Subject Range Query Range Percent Splice Strand
Cbp53E-RA 1..933 240..1172 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:39:10 Download gff for GH11671.complete
Subject Subject Range Query Range Percent Splice Strand
Cbp53E-RA 1..933 240..1172 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:02:00 Download gff for GH11671.complete
Subject Subject Range Query Range Percent Splice Strand
Cbp53E-RA 1..933 240..1172 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:23:03 Download gff for GH11671.complete
Subject Subject Range Query Range Percent Splice Strand
Cbp53E-RA 1..1318 1..1318 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:08:24 Download gff for GH11671.complete
Subject Subject Range Query Range Percent Splice Strand
Cbp53E-RA 1..1318 1..1318 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:23:50 Download gff for GH11671.complete
Subject Subject Range Query Range Percent Splice Strand
Cbp53E-RA 34..1351 1..1318 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:39:10 Download gff for GH11671.complete
Subject Subject Range Query Range Percent Splice Strand
Cbp53E-RA 1..1318 1..1318 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:02:00 Download gff for GH11671.complete
Subject Subject Range Query Range Percent Splice Strand
Cbp53E-RA 34..1351 1..1318 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:19:41 Download gff for GH11671.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16985919..16986005 567..653 100 -> Plus
2R 16986071..16986211 654..794 100 -> Plus
2R 16986581..16986636 795..850 100 -> Plus
2R 16986705..16986750 851..896 100 -> Plus
2R 16994160..16994216 897..953 100 -> Plus
2R 16994282..16994353 954..1025 100 -> Plus
2R 16994411..16994703 1026..1318 100   Plus
2R 16984266..16984490 166..390 100 -> Plus
2R 16984699..16984784 391..476 100 -> Plus
2R 16973960..16974124 1..165 100 -> Plus
2R 16984842..16984931 477..566 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:19:41 Download gff for GH11671.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16985919..16986005 567..653 100 -> Plus
2R 16986071..16986211 654..794 100 -> Plus
2R 16986581..16986636 795..850 100 -> Plus
2R 16986705..16986750 851..896 100 -> Plus
2R 16994160..16994216 897..953 100 -> Plus
2R 16994282..16994353 954..1025 100 -> Plus
2R 16994411..16994703 1026..1318 100   Plus
2R 16984266..16984490 166..390 100 -> Plus
2R 16984699..16984784 391..476 100 -> Plus
2R 16973960..16974124 1..165 100 -> Plus
2R 16984842..16984931 477..566 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:19:41 Download gff for GH11671.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16985919..16986005 567..653 100 -> Plus
2R 16986071..16986211 654..794 100 -> Plus
2R 16986581..16986636 795..850 100 -> Plus
2R 16986705..16986750 851..896 100 -> Plus
2R 16994160..16994216 897..953 100 -> Plus
2R 16994282..16994353 954..1025 100 -> Plus
2R 16994411..16994703 1026..1318 100   Plus
2R 16984266..16984490 166..390 100 -> Plus
2R 16984699..16984784 391..476 100 -> Plus
2R 16973960..16974124 1..165 100 -> Plus
2R 16984842..16984931 477..566 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:23:50 Download gff for GH11671.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12871771..12871995 166..390 100 -> Plus
arm_2R 12872204..12872289 391..476 100 -> Plus
arm_2R 12872347..12872436 477..566 100 -> Plus
arm_2R 12873424..12873510 567..653 100 -> Plus
arm_2R 12873576..12873716 654..794 100 -> Plus
arm_2R 12874086..12874141 795..850 100 -> Plus
arm_2R 12874210..12874255 851..896 100 -> Plus
arm_2R 12881665..12881721 897..953 100 -> Plus
arm_2R 12881787..12881858 954..1025 100 -> Plus
arm_2R 12881916..12882208 1026..1318 100   Plus
arm_2R 12861465..12861629 1..165 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:16:38 Download gff for GH11671.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16975159..16975323 1..165 100 -> Plus
2R 16985465..16985689 166..390 100 -> Plus
2R 16985898..16985983 391..476 100 -> Plus
2R 16986041..16986130 477..566 100 -> Plus
2R 16987118..16987204 567..653 100 -> Plus
2R 16987270..16987410 654..794 100 -> Plus
2R 16987780..16987835 795..850 100 -> Plus
2R 16987904..16987949 851..896 100 -> Plus
2R 16995359..16995415 897..953 100 -> Plus
2R 16995481..16995552 954..1025 100 -> Plus
2R 16995610..16995902 1026..1318 100   Plus

GH11671.pep Sequence

Translation from 239 to 1171

> GH11671.pep
MDSAAAAAAKRVQIEKAHNFMRQYRDPESRELKKLSANQFMDVWAHYDKD
GNGYIEGTELDGFLREFVSSANATDISPEAVTDTMLEELKSCFMEAYDDN
QDGKIDIRELAQLLPMEENFLLLFRFDNPLESSVEFMKIWREYDTDNSGY
IEADELKNFLRDLLKEAKKINDVSEDKLIEYTDTMLQVFDANKDGRLQLS
EMAKLLPVKENFLCRQVFKGATKLTKEDIEKVFSLYDRDNSGTIENEELK
GFLKDLLELVKKDDYDAQDLAAFEETIMRGVGTDKHGKISRKELTMILLT
LAKISPDDEE*

GH11671.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 12:28:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11427-PA 310 GF11427-PA 1..310 1..309 1591 98.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 12:28:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20649-PA 310 GG20649-PA 1..310 1..310 1624 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 12:28:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22953-PA 310 GH22953-PA 1..310 1..310 1607 98.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:52:14
Subject Length Description Subject Range Query Range Score Percent Strand
Cbp53E-PB 310 CG6702-PB 1..310 1..310 1583 100 Plus
Cbp53E-PA 310 CG6702-PA 1..310 1..310 1583 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 12:28:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18443-PA 311 GI18443-PA 1..311 1..310 1595 98.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 12:28:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11577-PA 310 GL11577-PA 1..310 1..310 1607 98.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 12:28:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19795-PA 310 GA19795-PA 1..310 1..310 1607 98.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 12:28:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21744-PA 311 GM21744-PA 1..311 1..310 1613 99.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 12:28:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11237-PA 310 GD11237-PA 1..310 1..310 1624 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 12:28:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21527-PA 311 GJ21527-PA 1..311 1..310 1599 98.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 12:28:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19573-PA 310 GK19573-PA 1..310 1..310 1613 99 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 12:28:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11635-PA 310 GE11635-PA 1..310 1..310 1621 99.7 Plus

GH11671.hyp Sequence

Translation from 239 to 1171

> GH11671.hyp
MDSAAAAAAKRVQIEKAHNFMRQYRDPESRELKKLSANQFMDVWAHYDKD
GNGYIEGTELDGFLREFVSSANATDISPEAVTDTMLEELKSCFMEAYDDN
QDGKIDIRELAQLLPMEENFLLLFRFDNPLESSVEFMKIWREYDTDNSGY
IEADELKNFLRDLLKEAKKINDVSEDKLIEYTDTMLQVFDANKDGRLQLS
EMAKLLPVKENFLCRQVFKGATKLTKEDIEKVFSLYDRDNSGTIENEELK
GFLKDLLELVKKDDYDAQDLAAFEETIMRGVGTDKHGKISRKELTMILLT
LAKISPDDEE*

GH11671.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:23:29
Subject Length Description Subject Range Query Range Score Percent Strand
Cbp53E-PB 310 CG6702-PB 1..310 1..310 1583 100 Plus
Cbp53E-PA 310 CG6702-PA 1..310 1..310 1583 100 Plus