BDGP Sequence Production Resources |
Search the DGRC for GH11672
Library: | GH |
Tissue Source: | Drosophila melanogaster head |
Created by: | Ling Hong |
Date Registered: | 1998-06-02 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 116 |
Well: | 72 |
Vector: | pOT2 |
Associated Gene/Transcript | grh-RM |
Protein status: | GH11672.pep: wuzgold |
Preliminary Size: | 1131 |
Sequenced Size: | 1077 |
Gene | Date | Evidence |
---|---|---|
CG5058 | 2002-10-15 | Blastp of sequenced clone |
CG5058 | 2003-01-01 | Sim4 clustering to Release 3 |
grh | 2008-04-29 | Release 5.5 accounting |
grh | 2008-08-15 | Release 5.9 accounting |
grh | 2008-12-18 | 5.12 accounting |
1077 bp (1077 high quality bases) assembled on 2002-10-15
GenBank Submission: BT001414
> GH11672.complete CTAACCGCAGCAGATCGAGCAGGCTCCCACCGCGTTTTAATTTAGCAATT ATCAAGCATTTTAATCGGTGGAAAATATTTGCAATTCTATTGCATCAAGC GCCAGTAGTAAGACCAGTAAGCGAGACAGCCCTCATATTACGTATACGCC ATGGGTTCGGTTTATCCTTTGCGATGCTCCGCCCATTTGCACAGTGAAAA AGTGGGCCATATTAGGCAAAGAATGACATTTTCTTAAAGATCAACATTGC GGTTCAGTGCTTGAGCACGGATTTCAGCAGTCAAAAGGGAGTTAAGGGCC TGCCGCTGCACGTACAAATCGACACATTTGAGGACCCCAGAGATACGGCG GTCTTCCACCGCGGCTACTGTCAGATAAAGGTCTTCTGCGATAAGGGCGC CGAACGAAAGACGCGCGATGAAGAGCGGCGGGCCGCCAAACGAAAGATGA CAGCCACGGGCAGAAAGAAGCTGGACGAGCTTTACCATCCGGTAACGGAT CGGTCCGAGTTCTATGGCATGCAGGACTTCGCCAAGCCGCCGGTGCTATT CTCGCCCGCCGAGGACATGGAGAAGAGCTTCTACGGCCATGAGACTGACT CGCCGGACCTGAAGGGGGCCTCACCGTTCCTGCTCCACGGCCAGAAGGTG GCCACGCCGACGCTCAAGTTCCACAACCATTTTCCGCCCGACATGCAGAC CGATAAGAAGGATCACATACTGGACCAGAACATGTTGACCAGCACACCCC TGACCGACTTTGGTCCGCCGATGAAGCGCGGCAGGATGACGCCGCCGACC TCGGAACGCGTGATGCTGTACGTGCGGCAGGAGAACGAGGAGGTGTATAC ACCGTTGCACGTGGTGCCGCCCACCACGATCGGCCTGCTAAATGCGGATT ACTGCGAAAATTGACGATGACATGATATCGTTCTACTGCAACGAGGACAT CTTTCTGCTGGAGGTGCAACAGATCGAGGACGACCTGTACGATGTGACGC TCACGGAGCTGCCCAATCAGTAGCGCTGGCAGTACGGGTAGCACCCGCTA ACCGCACTCAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
grh-RM | 1677 | grh-RM | 1..1069 | 1..1069 | 5345 | 100 | Plus |
grh.j | 6707 | grh.j | 3817..4155 | 237..575 | 1695 | 100 | Plus |
grh.s | 5500 | grh.s | 3817..4155 | 237..575 | 1695 | 100 | Plus |
grh.j | 6707 | grh.j | 4247..4569 | 574..896 | 1615 | 100 | Plus |
grh.s | 5500 | grh.s | 4247..4569 | 574..896 | 1615 | 100 | Plus |
grh.j | 6707 | grh.j | 4634..4807 | 896..1069 | 870 | 100 | Plus |
grh.s | 5500 | grh.s | 4634..4807 | 896..1069 | 870 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 13719757..13719997 | 1..239 | 1110 | 98.3 | Plus |
chr2R | 21145070 | chr2R | 13726739..13726935 | 701..897 | 955 | 99 | Plus |
chr2R | 21145070 | chr2R | 13726186..13726367 | 394..575 | 895 | 99.5 | Plus |
chr2R | 21145070 | chr2R | 13727896..13728059 | 896..1059 | 805 | 99.4 | Plus |
chr2R | 21145070 | chr2R | 13726459..13726585 | 574..700 | 635 | 100 | Plus |
chr2R | 21145070 | chr2R | 13722893..13722994 | 295..396 | 510 | 100 | Plus |
chr2R | 21145070 | chr2R | 13721760..13721819 | 238..297 | 300 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 17832605..17832843 | 1..239 | 1195 | 100 | Plus |
2R | 25286936 | 2R | 17839594..17839790 | 701..897 | 985 | 100 | Plus |
2R | 25286936 | 2R | 17839040..17839221 | 394..575 | 910 | 100 | Plus |
2R | 25286936 | 2R | 17840747..17840920 | 896..1069 | 870 | 100 | Plus |
2R | 25286936 | 2R | 17839313..17839439 | 574..700 | 635 | 100 | Plus |
2R | 25286936 | 2R | 17835749..17835850 | 295..396 | 510 | 100 | Plus |
2R | 25286936 | 2R | 17834613..17834672 | 238..297 | 300 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 17833804..17834042 | 1..239 | 1195 | 100 | Plus |
2R | 25260384 | 2R | 17840793..17840989 | 701..897 | 985 | 100 | Plus |
2R | 25260384 | 2R | 17840239..17840420 | 394..575 | 910 | 100 | Plus |
2R | 25260384 | 2R | 17841946..17842119 | 896..1069 | 870 | 100 | Plus |
2R | 25260384 | 2R | 17840512..17840638 | 574..700 | 635 | 100 | Plus |
2R | 25260384 | 2R | 17836948..17837049 | 295..396 | 510 | 100 | Plus |
2R | 25260384 | 2R | 17835812..17835871 | 238..297 | 300 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 13719757..13719997 | 1..239 | 98 | -> | Plus |
chr2R | 13721762..13721818 | 240..296 | 100 | -> | Plus |
chr2R | 13722895..13722993 | 297..395 | 100 | -> | Plus |
chr2R | 13726188..13726367 | 396..575 | 99 | -> | Plus |
chr2R | 13726461..13726585 | 576..700 | 100 | -> | Plus |
chr2R | 13726739..13726934 | 701..896 | 98 | -> | Plus |
chr2R | 13727897..13728059 | 897..1059 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
grh-RJ | 3058..3396 | 237..575 | 100 | -> | Plus |
grh-RJ | 3490..3807 | 576..893 | 100 | -> | Plus |
grh-RJ | 3874..4002 | 894..1023 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
grh-RK | 1411..1749 | 237..575 | 100 | -> | Plus |
grh-RK | 1843..2160 | 576..893 | 100 | -> | Plus |
grh-RK | 2227..2355 | 894..1023 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
grh-RH | 2248..2904 | 237..893 | 100 | -> | Plus |
grh-RH | 2971..3099 | 894..1023 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
grh-RJ | 3058..3396 | 237..575 | 100 | -> | Plus |
grh-RJ | 3490..3807 | 576..893 | 100 | -> | Plus |
grh-RJ | 3874..4002 | 894..1023 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
grh-RH | 2248..2904 | 237..893 | 100 | -> | Plus |
grh-RH | 2971..3099 | 894..1023 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
grh-RE | 1..1059 | 1..1059 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
grh-RM | 1..1059 | 1..1059 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
grh-RH | 3085..3741 | 237..893 | 100 | -> | Plus |
grh-RH | 3808..3972 | 894..1059 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
grh-RE | 1..1059 | 1..1059 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
grh-RH | 3085..3741 | 237..893 | 100 | -> | Plus |
grh-RH | 3808..3972 | 894..1059 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 17840748..17840910 | 897..1059 | 100 | Plus | |
2R | 17832605..17832843 | 1..239 | 100 | -> | Plus |
2R | 17834615..17834671 | 240..296 | 100 | -> | Plus |
2R | 17835751..17835849 | 297..395 | 100 | -> | Plus |
2R | 17839042..17839221 | 396..575 | 100 | -> | Plus |
2R | 17839315..17839439 | 576..700 | 100 | -> | Plus |
2R | 17839594..17839789 | 701..896 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 17840748..17840910 | 897..1059 | 100 | Plus | |
2R | 17832605..17832843 | 1..239 | 100 | -> | Plus |
2R | 17834615..17834671 | 240..296 | 100 | -> | Plus |
2R | 17835751..17835849 | 297..395 | 100 | -> | Plus |
2R | 17839042..17839221 | 396..575 | 100 | -> | Plus |
2R | 17839315..17839439 | 576..700 | 100 | -> | Plus |
2R | 17839594..17839789 | 701..896 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 17840748..17840910 | 897..1059 | 100 | Plus | |
2R | 17832605..17832843 | 1..239 | 100 | -> | Plus |
2R | 17834615..17834671 | 240..296 | 100 | -> | Plus |
2R | 17835751..17835849 | 297..395 | 100 | -> | Plus |
2R | 17839042..17839221 | 396..575 | 100 | -> | Plus |
2R | 17839315..17839439 | 576..700 | 100 | -> | Plus |
2R | 17839594..17839789 | 701..896 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 13728253..13728415 | 897..1059 | 100 | Plus | |
arm_2R | 13720110..13720348 | 1..239 | 100 | -> | Plus |
arm_2R | 13722120..13722176 | 240..296 | 100 | -> | Plus |
arm_2R | 13723256..13723354 | 297..395 | 100 | -> | Plus |
arm_2R | 13726547..13726726 | 396..575 | 100 | -> | Plus |
arm_2R | 13726820..13726944 | 576..700 | 100 | -> | Plus |
arm_2R | 13727099..13727294 | 701..896 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 17833804..17834042 | 1..239 | 100 | -> | Plus |
2R | 17835814..17835870 | 240..296 | 100 | -> | Plus |
2R | 17836950..17837048 | 297..395 | 100 | -> | Plus |
2R | 17840241..17840420 | 396..575 | 100 | -> | Plus |
2R | 17840514..17840638 | 576..700 | 100 | -> | Plus |
2R | 17840793..17840988 | 701..896 | 100 | -> | Plus |
2R | 17841947..17842109 | 897..1059 | 100 | Plus |
Translation from 446 to 913
> GH11672.hyp MTATGRKKLDELYHPVTDRSEFYGMQDFAKPPVLFSPAEDMEKSFYGHET DSPDLKGASPFLLHGQKVATPTLKFHNHFPPDMQTDKKDHILDQNMLTST PLTDFGPPMKRGRMTPPTSERVMLYVRQENEEVYTPLHVVPPTTIGLLNA DYCEN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
grh-PO | 698 | CG42311-PO | 486..635 | 1..150 | 809 | 100 | Plus |
grh-PH | 1032 | CG42311-PH | 820..969 | 1..150 | 809 | 100 | Plus |
grh-PL | 1302 | CG42311-PL | 1090..1239 | 1..150 | 809 | 100 | Plus |
grh-PN | 729 | CG42311-PN | 486..666 | 1..150 | 767 | 82.9 | Plus |
grh-PK | 784 | CG42311-PK | 541..721 | 1..150 | 767 | 82.9 | Plus |
Translation from 446 to 913
> GH11672.pep MTATGRKKLDELYHPVTDRSEFYGMQDFAKPPVLFSPAEDMEKSFYGHET DSPDLKGASPFLLHGQKVATPTLKFHNHFPPDMQTDKKDHILDQNMLTST PLTDFGPPMKRGRMTPPTSERVMLYVRQENEEVYTPLHVVPPTTIGLLNA DYCEN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF11678-PA | 694 | GF11678-PA | 482..631 | 1..150 | 804 | 99.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG21828-PA | 888 | GG21828-PA | 676..825 | 1..150 | 817 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH22029-PA | 1344 | GH22029-PA | 1132..1281 | 1..150 | 796 | 96 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
grh-PO | 698 | CG42311-PO | 486..635 | 1..150 | 809 | 100 | Plus |
grh-PH | 1032 | CG42311-PH | 820..969 | 1..150 | 809 | 100 | Plus |
grh-PL | 1302 | CG42311-PL | 1090..1239 | 1..150 | 809 | 100 | Plus |
grh-PN | 729 | CG42311-PN | 486..666 | 1..150 | 767 | 82.9 | Plus |
grh-PK | 784 | CG42311-PK | 541..721 | 1..150 | 767 | 82.9 | Plus |
grh-PP | 1063 | CG42311-PP | 820..1000 | 1..150 | 767 | 82.9 | Plus |
grh-PI | 1063 | CG5058-PA | 820..1000 | 1..150 | 767 | 82.9 | Plus |
grh-PJ | 1333 | CG5058-PD | 1090..1270 | 1..150 | 767 | 82.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI19118-PA | 1332 | GI19118-PA | 1120..1269 | 1..150 | 804 | 96.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17227-PA | 706 | GL17227-PA | 494..643 | 1..150 | 799 | 98 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA30279-PC | 1046 | GA30279-PC | 834..983 | 1..150 | 813 | 98 | Plus |
Dpse\GA30279-PJ | 643 | GA30279-PJ | 431..580 | 1..150 | 812 | 98 | Plus |
Dpse\GA30279-PB | 1321 | GA30279-PB | 1109..1258 | 1..150 | 812 | 98 | Plus |
Dpse\GA30279-PL | 918 | GA30279-PL | 706..855 | 1..150 | 809 | 98 | Plus |
Dpse\GA30279-PG | 703 | GA30279-PG | 491..640 | 1..150 | 799 | 98 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21828-PA | 697 | GM21828-PA | 485..634 | 1..150 | 809 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11322-PA | 697 | GD11322-PA | 485..634 | 1..150 | 809 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ22249-PA | 1173 | GJ22249-PA | 1002..1151 | 1..150 | 787 | 95.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK22232-PA | 698 | GK22232-PA | 485..635 | 1..150 | 774 | 96 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\grh-PA | 698 | GE11905-PA | 486..635 | 1..150 | 809 | 100 | Plus |