Clone GH11672 Report

Search the DGRC for GH11672

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:116
Well:72
Vector:pOT2
Associated Gene/Transcriptgrh-RM
Protein status:GH11672.pep: wuzgold
Preliminary Size:1131
Sequenced Size:1077

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5058 2002-10-15 Blastp of sequenced clone
CG5058 2003-01-01 Sim4 clustering to Release 3
grh 2008-04-29 Release 5.5 accounting
grh 2008-08-15 Release 5.9 accounting
grh 2008-12-18 5.12 accounting

Clone Sequence Records

GH11672.complete Sequence

1077 bp (1077 high quality bases) assembled on 2002-10-15

GenBank Submission: BT001414

> GH11672.complete
CTAACCGCAGCAGATCGAGCAGGCTCCCACCGCGTTTTAATTTAGCAATT
ATCAAGCATTTTAATCGGTGGAAAATATTTGCAATTCTATTGCATCAAGC
GCCAGTAGTAAGACCAGTAAGCGAGACAGCCCTCATATTACGTATACGCC
ATGGGTTCGGTTTATCCTTTGCGATGCTCCGCCCATTTGCACAGTGAAAA
AGTGGGCCATATTAGGCAAAGAATGACATTTTCTTAAAGATCAACATTGC
GGTTCAGTGCTTGAGCACGGATTTCAGCAGTCAAAAGGGAGTTAAGGGCC
TGCCGCTGCACGTACAAATCGACACATTTGAGGACCCCAGAGATACGGCG
GTCTTCCACCGCGGCTACTGTCAGATAAAGGTCTTCTGCGATAAGGGCGC
CGAACGAAAGACGCGCGATGAAGAGCGGCGGGCCGCCAAACGAAAGATGA
CAGCCACGGGCAGAAAGAAGCTGGACGAGCTTTACCATCCGGTAACGGAT
CGGTCCGAGTTCTATGGCATGCAGGACTTCGCCAAGCCGCCGGTGCTATT
CTCGCCCGCCGAGGACATGGAGAAGAGCTTCTACGGCCATGAGACTGACT
CGCCGGACCTGAAGGGGGCCTCACCGTTCCTGCTCCACGGCCAGAAGGTG
GCCACGCCGACGCTCAAGTTCCACAACCATTTTCCGCCCGACATGCAGAC
CGATAAGAAGGATCACATACTGGACCAGAACATGTTGACCAGCACACCCC
TGACCGACTTTGGTCCGCCGATGAAGCGCGGCAGGATGACGCCGCCGACC
TCGGAACGCGTGATGCTGTACGTGCGGCAGGAGAACGAGGAGGTGTATAC
ACCGTTGCACGTGGTGCCGCCCACCACGATCGGCCTGCTAAATGCGGATT
ACTGCGAAAATTGACGATGACATGATATCGTTCTACTGCAACGAGGACAT
CTTTCTGCTGGAGGTGCAACAGATCGAGGACGACCTGTACGATGTGACGC
TCACGGAGCTGCCCAATCAGTAGCGCTGGCAGTACGGGTAGCACCCGCTA
ACCGCACTCAAAAAAAAAAAAAAAAAA

GH11672.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:38:52
Subject Length Description Subject Range Query Range Score Percent Strand
grh-RM 1677 grh-RM 1..1069 1..1069 5345 100 Plus
grh.j 6707 grh.j 3817..4155 237..575 1695 100 Plus
grh.s 5500 grh.s 3817..4155 237..575 1695 100 Plus
grh.j 6707 grh.j 4247..4569 574..896 1615 100 Plus
grh.s 5500 grh.s 4247..4569 574..896 1615 100 Plus
grh.j 6707 grh.j 4634..4807 896..1069 870 100 Plus
grh.s 5500 grh.s 4634..4807 896..1069 870 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:29:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 13719757..13719997 1..239 1110 98.3 Plus
chr2R 21145070 chr2R 13726739..13726935 701..897 955 99 Plus
chr2R 21145070 chr2R 13726186..13726367 394..575 895 99.5 Plus
chr2R 21145070 chr2R 13727896..13728059 896..1059 805 99.4 Plus
chr2R 21145070 chr2R 13726459..13726585 574..700 635 100 Plus
chr2R 21145070 chr2R 13722893..13722994 295..396 510 100 Plus
chr2R 21145070 chr2R 13721760..13721819 238..297 300 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:44:55 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:29:18
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17832605..17832843 1..239 1195 100 Plus
2R 25286936 2R 17839594..17839790 701..897 985 100 Plus
2R 25286936 2R 17839040..17839221 394..575 910 100 Plus
2R 25286936 2R 17840747..17840920 896..1069 870 100 Plus
2R 25286936 2R 17839313..17839439 574..700 635 100 Plus
2R 25286936 2R 17835749..17835850 295..396 510 100 Plus
2R 25286936 2R 17834613..17834672 238..297 300 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:12:31
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 17833804..17834042 1..239 1195 100 Plus
2R 25260384 2R 17840793..17840989 701..897 985 100 Plus
2R 25260384 2R 17840239..17840420 394..575 910 100 Plus
2R 25260384 2R 17841946..17842119 896..1069 870 100 Plus
2R 25260384 2R 17840512..17840638 574..700 635 100 Plus
2R 25260384 2R 17836948..17837049 295..396 510 100 Plus
2R 25260384 2R 17835812..17835871 238..297 300 100 Plus
Blast to na_te.dros performed on 2019-03-15 21:29:19 has no hits.

GH11672.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:30:25 Download gff for GH11672.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 13719757..13719997 1..239 98 -> Plus
chr2R 13721762..13721818 240..296 100 -> Plus
chr2R 13722895..13722993 297..395 100 -> Plus
chr2R 13726188..13726367 396..575 99 -> Plus
chr2R 13726461..13726585 576..700 100 -> Plus
chr2R 13726739..13726934 701..896 98 -> Plus
chr2R 13727897..13728059 897..1059 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:35:59 Download gff for GH11672.complete
Subject Subject Range Query Range Percent Splice Strand
grh-RJ 3058..3396 237..575 100 -> Plus
grh-RJ 3490..3807 576..893 100 -> Plus
grh-RJ 3874..4002 894..1023 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:10:47 Download gff for GH11672.complete
Subject Subject Range Query Range Percent Splice Strand
grh-RK 1411..1749 237..575 100 -> Plus
grh-RK 1843..2160 576..893 100 -> Plus
grh-RK 2227..2355 894..1023 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:49:43 Download gff for GH11672.complete
Subject Subject Range Query Range Percent Splice Strand
grh-RH 2248..2904 237..893 100 -> Plus
grh-RH 2971..3099 894..1023 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:01:37 Download gff for GH11672.complete
Subject Subject Range Query Range Percent Splice Strand
grh-RJ 3058..3396 237..575 100 -> Plus
grh-RJ 3490..3807 576..893 100 -> Plus
grh-RJ 3874..4002 894..1023 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:55:00 Download gff for GH11672.complete
Subject Subject Range Query Range Percent Splice Strand
grh-RH 2248..2904 237..893 100 -> Plus
grh-RH 2971..3099 894..1023 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:32:15 Download gff for GH11672.complete
Subject Subject Range Query Range Percent Splice Strand
grh-RE 1..1059 1..1059 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:10:47 Download gff for GH11672.complete
Subject Subject Range Query Range Percent Splice Strand
grh-RM 1..1059 1..1059 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:49:43 Download gff for GH11672.complete
Subject Subject Range Query Range Percent Splice Strand
grh-RH 3085..3741 237..893 100 -> Plus
grh-RH 3808..3972 894..1059 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:01:38 Download gff for GH11672.complete
Subject Subject Range Query Range Percent Splice Strand
grh-RE 1..1059 1..1059 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:55:00 Download gff for GH11672.complete
Subject Subject Range Query Range Percent Splice Strand
grh-RH 3085..3741 237..893 100 -> Plus
grh-RH 3808..3972 894..1059 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:30:25 Download gff for GH11672.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17840748..17840910 897..1059 100   Plus
2R 17832605..17832843 1..239 100 -> Plus
2R 17834615..17834671 240..296 100 -> Plus
2R 17835751..17835849 297..395 100 -> Plus
2R 17839042..17839221 396..575 100 -> Plus
2R 17839315..17839439 576..700 100 -> Plus
2R 17839594..17839789 701..896 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:30:25 Download gff for GH11672.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17840748..17840910 897..1059 100   Plus
2R 17832605..17832843 1..239 100 -> Plus
2R 17834615..17834671 240..296 100 -> Plus
2R 17835751..17835849 297..395 100 -> Plus
2R 17839042..17839221 396..575 100 -> Plus
2R 17839315..17839439 576..700 100 -> Plus
2R 17839594..17839789 701..896 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:30:25 Download gff for GH11672.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17840748..17840910 897..1059 100   Plus
2R 17832605..17832843 1..239 100 -> Plus
2R 17834615..17834671 240..296 100 -> Plus
2R 17835751..17835849 297..395 100 -> Plus
2R 17839042..17839221 396..575 100 -> Plus
2R 17839315..17839439 576..700 100 -> Plus
2R 17839594..17839789 701..896 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:49:43 Download gff for GH11672.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13728253..13728415 897..1059 100   Plus
arm_2R 13720110..13720348 1..239 100 -> Plus
arm_2R 13722120..13722176 240..296 100 -> Plus
arm_2R 13723256..13723354 297..395 100 -> Plus
arm_2R 13726547..13726726 396..575 100 -> Plus
arm_2R 13726820..13726944 576..700 100 -> Plus
arm_2R 13727099..13727294 701..896 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:33:17 Download gff for GH11672.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17833804..17834042 1..239 100 -> Plus
2R 17835814..17835870 240..296 100 -> Plus
2R 17836950..17837048 297..395 100 -> Plus
2R 17840241..17840420 396..575 100 -> Plus
2R 17840514..17840638 576..700 100 -> Plus
2R 17840793..17840988 701..896 100 -> Plus
2R 17841947..17842109 897..1059 100   Plus

GH11672.hyp Sequence

Translation from 446 to 913

> GH11672.hyp
MTATGRKKLDELYHPVTDRSEFYGMQDFAKPPVLFSPAEDMEKSFYGHET
DSPDLKGASPFLLHGQKVATPTLKFHNHFPPDMQTDKKDHILDQNMLTST
PLTDFGPPMKRGRMTPPTSERVMLYVRQENEEVYTPLHVVPPTTIGLLNA
DYCEN*

GH11672.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:23:32
Subject Length Description Subject Range Query Range Score Percent Strand
grh-PO 698 CG42311-PO 486..635 1..150 809 100 Plus
grh-PH 1032 CG42311-PH 820..969 1..150 809 100 Plus
grh-PL 1302 CG42311-PL 1090..1239 1..150 809 100 Plus
grh-PN 729 CG42311-PN 486..666 1..150 767 82.9 Plus
grh-PK 784 CG42311-PK 541..721 1..150 767 82.9 Plus

GH11672.pep Sequence

Translation from 446 to 913

> GH11672.pep
MTATGRKKLDELYHPVTDRSEFYGMQDFAKPPVLFSPAEDMEKSFYGHET
DSPDLKGASPFLLHGQKVATPTLKFHNHFPPDMQTDKKDHILDQNMLTST
PLTDFGPPMKRGRMTPPTSERVMLYVRQENEEVYTPLHVVPPTTIGLLNA
DYCEN*

GH11672.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:19:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11678-PA 694 GF11678-PA 482..631 1..150 804 99.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:19:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21828-PA 888 GG21828-PA 676..825 1..150 817 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:19:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22029-PA 1344 GH22029-PA 1132..1281 1..150 796 96 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:23:18
Subject Length Description Subject Range Query Range Score Percent Strand
grh-PO 698 CG42311-PO 486..635 1..150 809 100 Plus
grh-PH 1032 CG42311-PH 820..969 1..150 809 100 Plus
grh-PL 1302 CG42311-PL 1090..1239 1..150 809 100 Plus
grh-PN 729 CG42311-PN 486..666 1..150 767 82.9 Plus
grh-PK 784 CG42311-PK 541..721 1..150 767 82.9 Plus
grh-PP 1063 CG42311-PP 820..1000 1..150 767 82.9 Plus
grh-PI 1063 CG5058-PA 820..1000 1..150 767 82.9 Plus
grh-PJ 1333 CG5058-PD 1090..1270 1..150 767 82.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:19:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19118-PA 1332 GI19118-PA 1120..1269 1..150 804 96.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:19:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17227-PA 706 GL17227-PA 494..643 1..150 799 98 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:19:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA30279-PC 1046 GA30279-PC 834..983 1..150 813 98 Plus
Dpse\GA30279-PJ 643 GA30279-PJ 431..580 1..150 812 98 Plus
Dpse\GA30279-PB 1321 GA30279-PB 1109..1258 1..150 812 98 Plus
Dpse\GA30279-PL 918 GA30279-PL 706..855 1..150 809 98 Plus
Dpse\GA30279-PG 703 GA30279-PG 491..640 1..150 799 98 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:20:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21828-PA 697 GM21828-PA 485..634 1..150 809 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:20:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11322-PA 697 GD11322-PA 485..634 1..150 809 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:20:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22249-PA 1173 GJ22249-PA 1002..1151 1..150 787 95.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:20:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22232-PA 698 GK22232-PA 485..635 1..150 774 96 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:20:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\grh-PA 698 GE11905-PA 486..635 1..150 809 100 Plus