GH11730.complete Sequence
843 bp (843 high quality bases) assembled on 2002-05-14
GenBank Submission: AY118774
> GH11730.complete
TTTTTTACAGCCGCAACATGATTTTTATGCCTGCTCTAAACTTGCTTGTG
TACAACGTACTTGTAGGTTACATAAGCATGGAAATCAATCGAATCATAAA
TGTTTCTACAGCCCAGACAAGTCTTTGGCAGAATATTCCTATTATCGGCC
AGATGTTCGCTCCGTTACAACCGGAAACCAATTATGGAGTGGAGTTCGGG
GAAAGCATGTGGGACTTTAACCTATATGTAAACATCTTACTGCTTCTCCC
CGCATTTTTTCAGATCTATCACATCTCCTTGCTGGTGGCGATTGTTCTCA
TGTGGAACTGCTACCTTCACCAGTGTCTGGCTGCTTTCCACCTGAAGATG
GTGTGGCACTTGTGGTGGAGCGACCTATGCTGGAGCTACTACGCTTCTCT
TGTCCTTTTCGGATTCCTGTTGACCATGCTGCACTTTAGTCTGATTATAG
CAACCGTTATGTATCAGATGCAGATCGACGGAGATCCCAAACCTCGGATC
CAGTCCGAGGCTCTCCCAGAGCAGCAGCCACATCCCGCAGAGGAAATTCA
GGAACGAATGGCAATGGCCCAGACCATTAAGATCTAAAAAATCAGACACT
AAACGACGGAGCACAGGTTCAGCCGCCTTTAAGTGGGTCACCATCAGTCA
GGGGCTTAACCTTGCCGCATCTACAAATACACTGGGTCGGTGGTTCAACT
AATAAATATGCCAGAAAACACCAGACACACAGATACCCCGCACGCACACA
CCAGCACACTACCGCAGACCAGGACATGTACAAATGAATCGCAGCTGAGG
TATAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
GH11730.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 19:08:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG11404-RA | 1110 | CG11404-RA | 123..922 | 1..800 | 4000 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:18:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 22537711..22538250 | 261..800 | 2700 | 100 | Plus |
chr3L | 24539361 | chr3L | 22537499..22537660 | 102..263 | 810 | 100 | Plus |
chr3L | 24539361 | chr3L | 22537351..22537452 | 1..102 | 510 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:45:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:18:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 22548803..22549342 | 261..800 | 2700 | 100 | Plus |
3L | 28110227 | 3L | 22548591..22548752 | 102..263 | 810 | 100 | Plus |
3L | 28110227 | 3L | 22548443..22548544 | 1..102 | 510 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:39:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 22541903..22542442 | 261..800 | 2700 | 100 | Plus |
3L | 28103327 | 3L | 22541691..22541852 | 102..263 | 810 | 100 | Plus |
3L | 28103327 | 3L | 22541543..22541644 | 1..102 | 510 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 06:18:03 has no hits.
GH11730.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:18:58 Download gff for
GH11730.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 22537500..22537660 | 103..263 | 100 | -> | Plus |
chr3L | 22537351..22537452 | 1..102 | 100 | -> | Plus |
chr3L | 22537714..22538250 | 264..803 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:36:11 Download gff for
GH11730.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11404-RA | 1..570 | 18..587 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:52:22 Download gff for
GH11730.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11404-RA | 1..570 | 18..587 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:26:50 Download gff for
GH11730.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11404-RA | 1..570 | 18..587 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:45:01 Download gff for
GH11730.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11404-RA | 1..570 | 18..587 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:20:11 Download gff for
GH11730.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11404-RA | 1..570 | 18..587 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:30:31 Download gff for
GH11730.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11404-RA | 7..771 | 1..765 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:52:22 Download gff for
GH11730.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11404-RA | 7..771 | 1..765 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:26:50 Download gff for
GH11730.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11404-RA | 7..806 | 1..800 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:45:01 Download gff for
GH11730.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11404-RA | 7..771 | 1..765 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:20:11 Download gff for
GH11730.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11404-RA | 7..806 | 1..800 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:18:58 Download gff for
GH11730.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 22548592..22548752 | 103..263 | 100 | -> | Plus |
3L | 22548443..22548544 | 1..102 | 100 | -> | Plus |
3L | 22548806..22549342 | 264..803 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:18:58 Download gff for
GH11730.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 22548592..22548752 | 103..263 | 100 | -> | Plus |
3L | 22548443..22548544 | 1..102 | 100 | -> | Plus |
3L | 22548806..22549342 | 264..803 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:18:58 Download gff for
GH11730.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 22548592..22548752 | 103..263 | 100 | -> | Plus |
3L | 22548443..22548544 | 1..102 | 100 | -> | Plus |
3L | 22548806..22549342 | 264..803 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:26:50 Download gff for
GH11730.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 22541543..22541644 | 1..102 | 100 | -> | Plus |
arm_3L | 22541692..22541852 | 103..263 | 100 | -> | Plus |
arm_3L | 22541906..22542442 | 264..803 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:17:24 Download gff for
GH11730.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 22541906..22542442 | 264..803 | 99 | | Plus |
3L | 22541543..22541644 | 1..102 | 100 | -> | Plus |
3L | 22541692..22541852 | 103..263 | 100 | -> | Plus |
GH11730.hyp Sequence
Translation from 2 to 586
> GH11730.hyp
FYSRNMIFMPALNLLVYNVLVGYISMEINRIINVSTAQTSLWQNIPIIGQ
MFAPLQPETNYGVEFGESMWDFNLYVNILLLLPAFFQIYHISLLVAIVLM
WNCYLHQCLAAFHLKMVWHLWWSDLCWSYYASLVLFGFLLTMLHFSLIIA
TVMYQMQIDGDPKPRIQSEALPEQQPHPAEEIQERMAMAQTIKI*
GH11730.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:24:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG11404-PA | 189 | CG11404-PA | 1..189 | 6..194 | 1005 | 100 | Plus |
CG11404-PB | 186 | CG11404-PB | 1..186 | 6..194 | 978 | 98.4 | Plus |
GH11730.pep Sequence
Translation from 17 to 586
> GH11730.pep
MIFMPALNLLVYNVLVGYISMEINRIINVSTAQTSLWQNIPIIGQMFAPL
QPETNYGVEFGESMWDFNLYVNILLLLPAFFQIYHISLLVAIVLMWNCYL
HQCLAAFHLKMVWHLWWSDLCWSYYASLVLFGFLLTMLHFSLIIATVMYQ
MQIDGDPKPRIQSEALPEQQPHPAEEIQERMAMAQTIKI*
GH11730.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:57:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF10982-PA | 177 | GF10982-PA | 5..170 | 15..189 | 179 | 32.6 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:57:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG16261-PA | 187 | GG16261-PA | 1..176 | 1..176 | 563 | 60.8 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:56:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG11404-PA | 189 | CG11404-PA | 1..189 | 1..189 | 1005 | 100 | Plus |
CG11404-PB | 186 | CG11404-PB | 1..186 | 1..189 | 978 | 98.4 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:57:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI11387-PA | 160 | GI11387-PA | 1..146 | 1..147 | 187 | 30.6 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:57:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM22452-PA | 194 | GM22452-PA | 6..194 | 1..189 | 890 | 87.8 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:57:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD15033-PA | 140 | GD15033-PA | 1..107 | 1..107 | 454 | 87.9 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 23:57:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ11642-PA | 185 | GJ11642-PA | 1..174 | 1..171 | 224 | 28.2 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:57:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE23283-PA | 186 | GE23283-PA | 1..175 | 1..176 | 614 | 63.6 | Plus |