Clone GH11752 Report

Search the DGRC for GH11752

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:117
Well:52
Vector:pOT2
Associated Gene/TranscriptwupA-RB
Protein status:GH11752.pep: gold
Sequenced Size:976

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
wupA-RB 2010-11-11 Gleaning Pick By Joe Carlson

Clone Sequence Records

GH11752.complete Sequence

976 bp assembled on 2010-11-23

GenBank Submission: BT125791.1

> GH11752.complete
TTCAGTCTTTTTGTGTCGTTCAGTATCATCCGATTCGTGTGATCGACAGC
ATAGCCGAATTTTTTTTCTTTTTTTTCTAATTCCTTGAAGTAACCAAAAA
CACAAATCAAAATGGCTGATGATGAGGCTAAGAAGGCTAAACAGGCTGAG
ATCGAGCGCAAGCGTGCTGAGGTGCGCAAGCGCATGGAGGAAGCCTCCAA
GGCCAAGAAGGCCAAGAAGGGTTTCATGACCCCAGAGAGGAAGAAGAAAC
TCAGGTTGCTGCTGCGTAAGAAAGCCGCTGAGGAGCTGAAGAAAGAACAG
GAACGCAAAGCGGCTGAACGTAGACGCATCATCGAAGAACGTTGCGGCAG
TCCCAGGAATCTCAGCGATGCCAGCGAAGATACTATTCAGAGTGTTTGTA
AGGACTACCACAGTAAGATACTGAAACTGGAGTCCGAAAAGTACGATTTC
GAGTACGATGTAGCCAGAAAGGATTATGAGATCAACGATCTCAATGCCCA
AGTTAACGATCTTCGCGGCAAGTTCGTCAAGCCAGCCCTGAAGAAGGTCT
CCAAATACGAAAACAAATTCGCCAAGCTGCAGAAGAAGGCCGCTGAGTTC
AACTTCCGCAACCAGCTCAAGGTGGTGAAGAAGAAGGAGTTCACGCTGGA
GGAGGAGGAGAAGGAGAAGAAACCCGACTGGTCCAAGGGCAAGCCCGGAG
ATGCCAAGGTGAAGGAGGAGGTTGAGGCCGAAGCTTAAGTGTCCACACGT
CCACTAGTGTCCACTGACCCGTGACTCCCGCCCTAAACAATAATTGAAAT
TATTTACAACAATTATCTGAAGCAATATAATTTATATGAATCTATTAATA
TATATATATATCCGCAAATATATATGCATGTATATATCTCGCCATATATA
TGTGTCCACAATGGATTTGATCAGAAATGAAGTCAATAAACAACAACAGC
AACAACTAAAAAAAAAAAAAAAAAAA

GH11752.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-17 01:12:33
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 17995055..17995347 957..665 1465 100 Minus
chrX 22417052 chrX 17995994..17996135 666..525 710 100 Minus
chrX 22417052 chrX 18002767..18002897 255..125 655 100 Minus
chrX 22417052 chrX 18002578..18002702 379..255 625 100 Minus
chrX 22417052 chrX 18001259..18001361 480..378 515 100 Minus
chrX 22417052 chrX 18006037..18006126 90..1 450 100 Minus
chrX 22417052 chrX 17996201..17996246 524..479 230 100 Minus
chrX 22417052 chrX 18003930..18003968 127..89 195 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 01:12:31
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 18105739..18106034 960..665 1480 100 Minus
X 23542271 X 18106681..18106822 666..525 710 100 Minus
X 23542271 X 18113447..18113577 255..125 655 100 Minus
X 23542271 X 18113258..18113382 379..255 625 100 Minus
X 23542271 X 18111938..18112040 480..378 515 100 Minus
X 23542271 X 18116707..18116796 90..1 450 100 Minus
X 23542271 X 18106888..18106933 524..479 230 100 Minus
X 23542271 X 18114610..18114648 127..89 195 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:03:21
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 18113837..18114132 960..665 1480 100 Minus
X 23527363 X 18114779..18114920 666..525 710 100 Minus
X 23527363 X 18121545..18121675 255..125 655 100 Minus
X 23527363 X 18121356..18121480 379..255 625 100 Minus
X 23527363 X 18120036..18120138 480..378 515 100 Minus
X 23527363 X 18124805..18124894 90..1 450 100 Minus
X 23527363 X 18114986..18115031 524..479 230 100 Minus
X 23527363 X 18122708..18122746 127..89 195 100 Minus
Blast to na_te.dros performed 2019-03-17 01:12:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\Osvaldo 9045 Dbuz\Osvaldo DBU133521 9045bp Derived from AJ133521 (Rel. 60, Last updated, Version 2). 1993..2036 911..953 109 75 Plus

GH11752.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 01:13:22 Download gff for GH11752.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 17995188..17995345 667..824 100 <- Minus
chrX 17995994..17996135 525..666 100 <- Minus
chrX 17996201..17996244 481..524 100 <- Minus
chrX 18001259..18001359 380..480 100 <- Minus
chrX 18002578..18002701 256..379 100 <- Minus
chrX 18002767..18002895 127..255 100 <- Minus
chrX 18003931..18003966 91..126 100 <- Minus
chrX 18006037..18006126 1..90 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-12-01 12:57:19 Download gff for GH11752.complete
Subject Subject Range Query Range Percent Splice Strand
wupA-RB 1..627 112..738 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:44:23 Download gff for GH11752.complete
Subject Subject Range Query Range Percent Splice Strand
wupA-RB 1..627 112..738 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:32:19 Download gff for GH11752.complete
Subject Subject Range Query Range Percent Splice Strand
wupA-RB 1..627 112..738 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:51:52 Download gff for GH11752.complete
Subject Subject Range Query Range Percent Splice Strand
wupA-RB 1..627 112..738 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-12-01 12:57:19 Download gff for GH11752.complete
Subject Subject Range Query Range Percent Splice Strand
wupA-RB 27..983 1..957 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:44:23 Download gff for GH11752.complete
Subject Subject Range Query Range Percent Splice Strand
wupA-RB 27..983 1..957 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:32:19 Download gff for GH11752.complete
Subject Subject Range Query Range Percent Splice Strand
wupA-RB 30..986 1..957 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:51:52 Download gff for GH11752.complete
Subject Subject Range Query Range Percent Splice Strand
wupA-RB 30..986 1..957 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:13:22 Download gff for GH11752.complete
Subject Subject Range Query Range Percent Splice Strand
X 18105742..18106032 667..957 100 <- Minus
X 18106681..18106822 525..666 100 <- Minus
X 18106888..18106931 481..524 100 <- Minus
X 18111938..18112038 380..480 100 <- Minus
X 18113258..18113381 256..379 100 <- Minus
X 18113447..18113575 127..255 100 <- Minus
X 18114611..18114646 91..126 100 <- Minus
X 18116707..18116796 1..90 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:13:22 Download gff for GH11752.complete
Subject Subject Range Query Range Percent Splice Strand
X 18105742..18106032 667..957 100 <- Minus
X 18106681..18106822 525..666 100 <- Minus
X 18106888..18106931 481..524 100 <- Minus
X 18111938..18112038 380..480 100 <- Minus
X 18113258..18113381 256..379 100 <- Minus
X 18113447..18113575 127..255 100 <- Minus
X 18114611..18114646 91..126 100 <- Minus
X 18116707..18116796 1..90 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:13:22 Download gff for GH11752.complete
Subject Subject Range Query Range Percent Splice Strand
X 18105742..18106032 667..957 100 <- Minus
X 18106681..18106822 525..666 100 <- Minus
X 18106888..18106931 481..524 100 <- Minus
X 18111938..18112038 380..480 100 <- Minus
X 18113258..18113381 256..379 100 <- Minus
X 18113447..18113575 127..255 100 <- Minus
X 18114611..18114646 91..126 100 <- Minus
X 18116707..18116796 1..90 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:32:19 Download gff for GH11752.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18000921..18000964 481..524 100 <- Minus
arm_X 18005971..18006071 380..480 100 <- Minus
arm_X 18007291..18007414 256..379 100 <- Minus
arm_X 18007480..18007608 127..255 100 <- Minus
arm_X 18008644..18008679 91..126 100 <- Minus
arm_X 18010740..18010829 1..90 100   Minus
arm_X 17999775..18000065 667..957 100 <- Minus
arm_X 18000714..18000855 525..666 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:51:34 Download gff for GH11752.complete
Subject Subject Range Query Range Percent Splice Strand
X 18113840..18114130 667..957 100 <- Minus
X 18114779..18114920 525..666 100 <- Minus
X 18114986..18115029 481..524 100 <- Minus
X 18120036..18120136 380..480 100 <- Minus
X 18121356..18121479 256..379 100 <- Minus
X 18121545..18121673 127..255 100 <- Minus
X 18122709..18122744 91..126 100 <- Minus
X 18124805..18124894 1..90 100   Minus

GH11752.hyp Sequence

Translation from 111 to 737

> GH11752.hyp
MADDEAKKAKQAEIERKRAEVRKRMEEASKAKKAKKGFMTPERKKKLRLL
LRKKAAEELKKEQERKAAERRRIIEERCGSPRNLSDASEDTIQSVCKDYH
SKILKLESEKYDFEYDVARKDYEINDLNAQVNDLRGKFVKPALKKVSKYE
NKFAKLQKKAAEFNFRNQLKVVKKKEFTLEEEEKEKKPDWSKGKPGDAKV
KEEVEAEA*

GH11752.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:01:03
Subject Length Description Subject Range Query Range Score Percent Strand
wupA-PB 208 CG7178-PB 1..208 1..208 1047 100 Plus
wupA-PA 208 CG7178-PA 1..208 1..208 962 92.3 Plus
wupA-PF 208 CG7178-PF 1..208 1..208 950 89.4 Plus
wupA-PC 208 CG7178-PC 1..208 1..208 950 89.4 Plus
wupA-PE 208 CG7178-PE 1..208 1..208 927 88.9 Plus

GH11752.pep Sequence

Translation from 111 to 737

> GH11752.pep
MADDEAKKAKQAEIERKRAEVRKRMEEASKAKKAKKGFMTPERKKKLRLL
LRKKAAEELKKEQERKAAERRRIIEERCGSPRNLSDASEDTIQSVCKDYH
SKILKLESEKYDFEYDVARKDYEINDLNAQVNDLRGKFVKPALKKVSKYE
NKFAKLQKKAAEFNFRNQLKVVKKKEFTLEEEEKEKKPDWSKGKPGDAKV
KEEVEAEA*

GH11752.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 10:48:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19521-PA 272 GF19521-PA 68..272 4..208 749 91.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 10:48:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18142-PA 269 GG18142-PA 65..269 4..208 750 91.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 10:48:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11970-PA 282 GH11970-PA 78..282 4..208 735 88.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:52:38
Subject Length Description Subject Range Query Range Score Percent Strand
wupA-PB 208 CG7178-PB 1..208 1..208 1047 100 Plus
wupA-PA 208 CG7178-PA 1..208 1..208 962 92.3 Plus
wupA-PF 208 CG7178-PF 1..208 1..208 950 89.4 Plus
wupA-PC 208 CG7178-PC 1..208 1..208 950 89.4 Plus
wupA-PG 269 CG7178-PG 65..269 4..208 931 88.8 Plus
wupA-PE 208 CG7178-PE 1..208 1..208 927 88.9 Plus
wupA-PD 208 CG7178-PD 1..208 1..208 927 88.9 Plus
wupA-PJ 199 CG7178-PJ 1..187 1..187 849 91.4 Plus
wupA-PM 184 CG7178-PM 1..184 25..208 847 91.3 Plus
wupA-PL 184 CG7178-PL 1..184 25..208 847 91.3 Plus
wupA-PK 184 CG7178-PK 1..184 25..208 847 91.3 Plus
wupA-PH 260 CG7178-PH 65..248 4..187 818 87.5 Plus
wupA-PI 199 CG7178-PI 1..187 1..187 814 87.7 Plus
up-PM 373 CG7107-PM 83..300 5..196 157 27.8 Plus
up-PL 388 CG7107-PL 98..315 5..196 157 28.7 Plus
up-PN 394 CG7107-PN 104..321 5..196 157 28.7 Plus
up-PK 396 CG7107-PK 106..323 5..196 157 28.7 Plus
up-PG 396 CG7107-PG 106..323 5..196 157 28.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 10:48:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14711-PA 277 GI14711-PA 73..277 4..208 737 88.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 10:48:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14173-PA 267 GL14173-PA 63..267 4..208 712 88.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 10:48:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\TpnI-PA 267 GA22383-PA 63..267 4..208 712 88.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 10:48:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22835-PA 224 GM22835-PA 65..224 4..208 580 73.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 10:48:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24482-PA 98 GD24482-PA 13..97 6..90 392 98.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 10:48:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\wupA-PA 274 GJ16776-PA 70..274 4..208 737 88.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 10:48:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24919-PA 272 GK24919-PA 68..272 4..208 737 88.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 10:48:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\wupA-PA 270 GE15552-PA 66..270 4..208 715 88.3 Plus