Clone GH11850 Report

Search the DGRC for GH11850

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:118
Well:50
Vector:pOT2
Associated Gene/TranscriptMst35Bb-RA
Protein status:GH11850.pep: gold
Preliminary Size:671
Sequenced Size:696

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4478 2002-01-01 Sim4 clustering to Release 2
CG4478 2002-05-18 Blastp of sequenced clone
CG4478 2003-01-01 Sim4 clustering to Release 3
Mst35Bb 2008-04-29 Release 5.5 accounting
Mst35Bb 2008-08-15 Release 5.9 accounting
Mst35Bb 2008-12-18 5.12 accounting

Clone Sequence Records

GH11850.complete Sequence

696 bp (696 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118776

> GH11850.complete
CACAAACAGTTCACAAGCAAAATTTTTCCAAAAATTTATAGTCTTATTTT
TATGATCTTCTTAAAAATTAGTTGTGACAAAAATTTGGTTTTTATAAAAA
ACTTCATAAGGAGTTTGTAAAAATTTTCTACGATGAGTTCAAATAATGTA
AATGAGTGCAAGAGCCTGTGGAATGGCATAATTTCCATTTCTGCAAAAGA
TGAAAGTCCTAAAGGTCTCACTGAAATGTGTAATCATCCAAAGAGGAGAG
CACCGCCCAAATGTAAGCCAATGAAGTCCTGTGCAAAGCCGCGCCGAAAG
GCAGCCTGTGCCAAGGCGACTCGGCCCAAGGTCAAGTGTGCACCGAGTCA
GAAGTGCAGCAAGCAGGGACCTGTCACTAACAACGCCTATTTGAATTTCG
TGCGTTTCTTCCGAAAGAAGCACTGTGACTTGAAGCCGCAGGAATTAATT
GCAGAGGCCGCTAAAGCGTGGGCCGAGCTCCCGGAGCATAGAAAGGATAG
ATACCGCCGGATGGCATGCAAGGTCACCACCAGTGAACGCCACAAGCGCC
GACGGATTTGCAAGTAATACTGAGATAGGAAAAAGTCTGATGCAGTTAAG
TCCAGGCATATATTTTCATTGATTTGATACCATTCGATGAATTTAGAAAT
AAAAAAAATTAAAAACCGGGAAAAAAAAAAAAAAAAAAAAAAAAAA

GH11850.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:04:31
Subject Length Description Subject Range Query Range Score Percent Strand
Mst35Bb-RA 844 Mst35Bb-RA 174..843 1..670 3350 100 Plus
Mst35Ba-RA 696 Mst35Ba-RA 38..642 1..611 2515 94.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:25:10
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 14881049..14881452 514..111 2020 100 Minus
chr2L 23010047 chr2L 14877988..14878388 514..114 1720 95.3 Minus
chr2L 23010047 chr2L 14880843..14881001 670..513 745 99.4 Minus
chr2L 23010047 chr2L 14882345..14882455 111..1 555 100 Minus
chr2L 23010047 chr2L 14877842..14877940 611..513 465 98 Minus
chr2L 23010047 chr2L 14880273..14880366 101..1 305 89.1 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:45:14 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:25:08
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 14882306..14882709 514..111 2020 100 Minus
2L 23513712 2L 14879237..14879640 514..111 1765 95.8 Minus
2L 23513712 2L 14882101..14882258 670..513 790 100 Minus
2L 23513712 2L 14883602..14883712 111..1 555 100 Minus
2L 23513712 2L 14879091..14879189 611..513 465 98 Minus
2L 23513712 2L 14881522..14881615 101..1 305 89.1 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:35:56
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 14882306..14882709 514..111 2020 100 Minus
2L 23513712 2L 14879237..14879640 514..111 1765 95.7 Minus
2L 23513712 2L 14882101..14882258 670..513 790 100 Minus
2L 23513712 2L 14883602..14883712 111..1 555 100 Minus
2L 23513712 2L 14879091..14879189 611..513 465 97.9 Minus
2L 23513712 2L 14881522..14881615 101..1 315 89.1 Minus
Blast to na_te.dros performed on 2019-03-16 23:25:08 has no hits.

GH11850.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:26:42 Download gff for GH11850.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 14880843..14881000 514..670 99 <- Minus
chr2L 14881050..14881451 112..513 100 <- Minus
chr2L 14882345..14882455 1..111 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:36:24 Download gff for GH11850.complete
Subject Subject Range Query Range Percent Splice Strand
Mst35Bb-RA 1..435 133..567 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:46:27 Download gff for GH11850.complete
Subject Subject Range Query Range Percent Splice Strand
Mst35Bb-RA 1..435 133..567 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:42:36 Download gff for GH11850.complete
Subject Subject Range Query Range Percent Splice Strand
Mst35Bb-RA 1..435 133..567 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:38:43 Download gff for GH11850.complete
Subject Subject Range Query Range Percent Splice Strand
Mst35Bb-RA 1..435 133..567 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:49:16 Download gff for GH11850.complete
Subject Subject Range Query Range Percent Splice Strand
Mst35Bb-RA 1..435 133..567 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:22:07 Download gff for GH11850.complete
Subject Subject Range Query Range Percent Splice Strand
Mst35Bb-RA 4..673 1..670 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:46:27 Download gff for GH11850.complete
Subject Subject Range Query Range Percent Splice Strand
Mst35Bb-RA 4..673 1..670 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:42:36 Download gff for GH11850.complete
Subject Subject Range Query Range Percent Splice Strand
Mst35Bb-RA 10..679 1..670 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:38:44 Download gff for GH11850.complete
Subject Subject Range Query Range Percent Splice Strand
Mst35Bb-RA 4..673 1..670 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:49:16 Download gff for GH11850.complete
Subject Subject Range Query Range Percent Splice Strand
Mst35Bb-RA 10..679 1..670 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:26:42 Download gff for GH11850.complete
Subject Subject Range Query Range Percent Splice Strand
2L 14883602..14883712 1..111 100   Minus
2L 14882101..14882257 514..670 100 <- Minus
2L 14882307..14882708 112..513 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:26:42 Download gff for GH11850.complete
Subject Subject Range Query Range Percent Splice Strand
2L 14883602..14883712 1..111 100   Minus
2L 14882101..14882257 514..670 100 <- Minus
2L 14882307..14882708 112..513 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:26:42 Download gff for GH11850.complete
Subject Subject Range Query Range Percent Splice Strand
2L 14883602..14883712 1..111 100   Minus
2L 14882101..14882257 514..670 100 <- Minus
2L 14882307..14882708 112..513 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:42:36 Download gff for GH11850.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 14882101..14882257 514..670 100 <- Minus
arm_2L 14882307..14882708 112..513 100 <- Minus
arm_2L 14883602..14883712 1..111 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:11:08 Download gff for GH11850.complete
Subject Subject Range Query Range Percent Splice Strand
2L 14882307..14882708 112..513 100 <- Minus
2L 14883602..14883712 1..111 100   Minus
2L 14882101..14882257 514..670 100 <- Minus

GH11850.pep Sequence

Translation from 132 to 566

> GH11850.pep
MSSNNVNECKSLWNGIISISAKDESPKGLTEMCNHPKRRAPPKCKPMKSC
AKPRRKAACAKATRPKVKCAPSQKCSKQGPVTNNAYLNFVRFFRKKHCDL
KPQELIAEAAKAWAELPEHRKDRYRRMACKVTTSERHKRRRICK*

GH11850.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:02:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15002-PA 331 GF15002-PA 37..146 45..140 263 53.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:02:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24235-PA 202 GG24235-PA 69..198 15..143 466 74.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:02:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH25261-PA 93 GH25261-PA 2..91 49..143 255 55.8 Plus
Dgri\GH10828-PA 277 GH10828-PA 37..109 49..126 188 50 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:22:55
Subject Length Description Subject Range Query Range Score Percent Strand
ProtB-PA 144 CG4478-PA 1..144 1..144 786 100 Plus
ProtA-PB 146 CG4479-PB 1..144 1..144 720 92.4 Plus
ProtA-PA 146 CG4479-PA 1..144 1..144 720 92.4 Plus
CG46193-PA 102 CG46193-PA 9..70 44..116 200 53.4 Plus
CG46191-PA 102 CG46191-PA 7..70 48..116 176 50.7 Plus
CG46192-PA 133 CG46192-PA 38..101 48..116 175 50.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:02:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17338-PA 277 GI17338-PA 205..274 74..143 255 65.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:02:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14516-PA 84 GL14516-PA 15..64 77..126 152 52 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:02:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18970-PA 569 GA18970-PA 12..64 74..126 145 49.1 Plus
Dpse\GA25629-PA 201 GA25629-PA 73..121 79..125 143 55.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:02:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14632-PA 147 GM14632-PA 1..145 1..143 545 76.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:02:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21981-PA 147 GD21981-PA 1..145 1..143 542 77.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:02:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16066-PA 212 GJ16066-PA 106..210 38..143 272 56 Plus
Dvir\GJ18244-PA 199 GJ18244-PA 126..196 73..143 165 46.5 Plus
Dvir\GJ16060-PA 203 GJ16060-PA 127..198 53..126 162 44.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:02:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18077-PA 235 GK18077-PA 135..232 36..143 292 61.1 Plus
Dwil\GK14607-PA 224 GK14607-PA 121..221 42..144 287 58.7 Plus
Dwil\GK12423-PA 138 GK12423-PA 38..135 36..143 271 57.4 Plus
Dwil\GK21287-PA 153 GK21287-PA 68..140 36..118 184 53 Plus
Dwil\GK21014-PA 147 GK21014-PA 69..139 36..116 175 51.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:02:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24787-PA 217 GE24787-PA 69..214 15..143 454 66.7 Plus

GH11850.hyp Sequence

Translation from 132 to 566

> GH11850.hyp
MSSNNVNECKSLWNGIISISAKDESPKGLTEMCNHPKRRAPPKCKPMKSC
AKPRRKAACAKATRPKVKCAPSQKCSKQGPVTNNAYLNFVRFFRKKHCDL
KPQELIAEAAKAWAELPEHRKDRYRRMACKVTTSERHKRRRICK*

GH11850.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:25:32
Subject Length Description Subject Range Query Range Score Percent Strand
Mst35Bb-PA 144 CG4478-PA 1..144 1..144 786 100 Plus
Mst35Ba-PB 146 CG4479-PB 1..144 1..144 720 92.4 Plus
Mst35Ba-PA 146 CG4479-PA 1..144 1..144 720 92.4 Plus