Clone GH11940 Report

Search the DGRC for GH11940

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:119
Well:40
Vector:pOT2
Associated Gene/TranscriptNacalpha-RA
Protein status:GH11940.pep: gold
Preliminary Size:1048
Sequenced Size:890

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8759 2001-01-01 Release 2 assignment
CG8759 2002-11-11 Blastp of sequenced clone
CG8759 2003-01-01 Sim4 clustering to Release 3
Nacalpha 2008-04-29 Release 5.5 accounting
Nacalpha 2008-08-15 Release 5.9 accounting
Nacalpha 2008-12-18 5.12 accounting

Clone Sequence Records

GH11940.complete Sequence

890 bp (890 high quality bases) assembled on 2002-11-11

GenBank Submission: AY075332

> GH11940.complete
TCACACTCCCCTCCGCCATATTTCTTTTCTTCGTTTCCGATTAAAATGCC
CGAACTGACCGAAATCAAGAGCGAGGCTGCGCCCTCCACCTCCGCTGAGG
CGAAACCCGAGGACGTCCGCGTTGAGGATGATGGCAGTGATAGCGACTCC
GATGGTGGCATGCCTGGTCTGGAGGAGGCTGTAGCGGCCACCACACAGCT
GGGTGGAGGTGCCACCGGTCTGCCCATCGACCTCGTCTCAAAGGCCAAGC
AATCGCGCGGCGAGAAAAAGGCCAGGAAGATCATGCTGAAGCTGGGACTT
AAGCAGATCCAGGGCGTCAACCGGGTGACGATCAGGAAGTCGAAGAACAT
CCTGTTCGTGATCAACAACCCAGATGTGTACAAGAACCCCCACAGCGACA
CCTACATCGTGTTCGGTGAGGCCAAGATCGAGGATCTGTCGCAACAGGCC
CAGGTGGCTGCCGCCGAGAAGTTCAAGGCCCCGGAGGCTGCTGGCGCTGC
AGACAGCGTGGGCGCCACCACATCGGTGGCCCCCATTGCCGAGGAAGACG
AGGAGGATGTCGATGACACCGGCGTGGATGAGAAGGATATCGAGCTGGTC
ATCACGCAGGCCAACACGACGAGGGCCAAGGCGATCAAGGCTCTGAAGAA
CAACAACAATGACATCGTCAACGCCATCATGGAGCTTACTATGCTTTAGA
GCGGGCTTCAGCGTTAGCTGCACTCCTGATTTTGTTGTTTACCCGCCTTT
CGATAATACTGACCCAAATGTTGTGCATGCCCCTCAAGGGGCAGCATGTT
ACACCAGTCGAACATTTAATTATATTTCAAAAGATTGCGTCTTAATAAAA
ATGGATTTATTTCAAATCAAAAAAAAAAAAAAAAAAAAAA

GH11940.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:35:01
Subject Length Description Subject Range Query Range Score Percent Strand
Nacalpha-RB 1030 Nacalpha-RB 157..1027 1..871 4355 100 Plus
Nacalpha-RC 944 Nacalpha-RC 67..941 1..871 4290 99.5 Plus
Nacalpha-RA 927 Nacalpha-RA 93..924 40..871 4160 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:22:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8646894..8647723 868..39 4150 100 Minus
chrU 10048995 chrU 598585..598697 756..867 350 91.2 Plus
chrU 10048995 chrU 598519..598577 636..694 250 94.9 Plus
chr2R 21145070 chr2R 8648006..8648044 39..1 195 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:45:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:22:27
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12759690..12760522 871..39 4165 100 Minus
3R 32079331 3R 1516540..1516652 756..867 350 91.2 Plus
3R 32079331 3R 1516474..1516532 636..694 250 94.9 Plus
2R 25286936 2R 12760805..12760843 39..1 195 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:09:40
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12760889..12761721 871..39 4165 100 Minus
3R 31820162 3R 1314118..1314230 756..867 375 92.9 Plus
3R 31820162 3R 1314052..1314110 636..694 250 94.9 Plus
2R 25260384 2R 12762004..12762042 39..1 195 100 Minus
Blast to na_te.dros performed on 2019-03-15 15:22:28 has no hits.

GH11940.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:23:16 Download gff for GH11940.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8646894..8647722 40..868 100 <- Minus
chr2R 8648006..8648044 1..39 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:36:35 Download gff for GH11940.complete
Subject Subject Range Query Range Percent Splice Strand
Nacalpha-RA 1..654 46..699 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:06:27 Download gff for GH11940.complete
Subject Subject Range Query Range Percent Splice Strand
Nacalpha-RA 1..654 46..699 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:26:25 Download gff for GH11940.complete
Subject Subject Range Query Range Percent Splice Strand
Nacalpha-RB 1..654 46..699 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:56:18 Download gff for GH11940.complete
Subject Subject Range Query Range Percent Splice Strand
Nacalpha-RA 1..654 46..699 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:04:19 Download gff for GH11940.complete
Subject Subject Range Query Range Percent Splice Strand
Nacalpha-RC 1..654 46..699 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:26:06 Download gff for GH11940.complete
Subject Subject Range Query Range Percent Splice Strand
Nacalpha-RB 30..897 1..868 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:06:27 Download gff for GH11940.complete
Subject Subject Range Query Range Percent Splice Strand
Nacalpha-RB 30..897 1..868 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:26:25 Download gff for GH11940.complete
Subject Subject Range Query Range Percent Splice Strand
Nacalpha-RB 157..1024 1..868 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:56:18 Download gff for GH11940.complete
Subject Subject Range Query Range Percent Splice Strand
Nacalpha-RB 30..897 1..868 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:04:19 Download gff for GH11940.complete
Subject Subject Range Query Range Percent Splice Strand
Nacalpha-RB 157..1024 1..868 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:23:16 Download gff for GH11940.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12759693..12760521 40..868 100 <- Minus
2R 12760805..12760843 1..39 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:23:16 Download gff for GH11940.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12759693..12760521 40..868 100 <- Minus
2R 12760805..12760843 1..39 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:23:16 Download gff for GH11940.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12759693..12760521 40..868 100 <- Minus
2R 12760805..12760843 1..39 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:26:25 Download gff for GH11940.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8647198..8648026 40..868 100 <- Minus
arm_2R 8648310..8648348 1..39 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:28:45 Download gff for GH11940.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12760892..12761720 40..868 100 <- Minus
2R 12762004..12762042 1..39 100   Minus

GH11940.hyp Sequence

Translation from 1 to 698

> GH11940.hyp
SHSPPPYFFSSFPIKMPELTEIKSEAAPSTSAEAKPEDVRVEDDGSDSDS
DGGMPGLEEAVAATTQLGGGATGLPIDLVSKAKQSRGEKKARKIMLKLGL
KQIQGVNRVTIRKSKNILFVINNPDVYKNPHSDTYIVFGEAKIEDLSQQA
QVAAAEKFKAPEAAGAADSVGATTSVAPIAEEDEEDVDDTGVDEKDIELV
ITQANTTRAKAIKALKNNNNDIVNAIMELTML*

GH11940.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:26:15
Subject Length Description Subject Range Query Range Score Percent Strand
Nacalpha-PD 217 CG8759-PD 1..217 16..232 1071 100 Plus
Nacalpha-PA 217 CG8759-PA 1..217 16..232 1071 100 Plus
Nacalpha-PC 217 CG8759-PC 1..217 16..232 1071 100 Plus
Nacalpha-PB 217 CG8759-PB 1..217 16..232 1071 100 Plus
CG4415-PB 347 CG4415-PB 145..346 41..231 350 45.1 Plus

GH11940.pep Sequence

Translation from 45 to 698

> GH11940.pep
MPELTEIKSEAAPSTSAEAKPEDVRVEDDGSDSDSDGGMPGLEEAVAATT
QLGGGATGLPIDLVSKAKQSRGEKKARKIMLKLGLKQIQGVNRVTIRKSK
NILFVINNPDVYKNPHSDTYIVFGEAKIEDLSQQAQVAAAEKFKAPEAAG
AADSVGATTSVAPIAEEDEEDVDDTGVDEKDIELVITQANTTRAKAIKAL
KNNNNDIVNAIMELTML*

GH11940.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:41:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13093-PA 217 GF13093-PA 1..217 1..217 1078 97.2 Plus
Dana\GF24131-PA 287 GF24131-PA 121..286 58..216 356 50 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:41:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22551-PA 217 GG22551-PA 1..217 1..217 1081 97.2 Plus
Dere\GG24760-PA 340 GG24760-PA 119..339 13..216 267 39.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:41:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21313-PA 218 GH21313-PA 1..218 1..217 949 92.3 Plus
Dgri\GH22262-PA 218 GH22262-PA 1..218 1..217 949 92.3 Plus
Dgri\GH13684-PA 263 GH13684-PA 104..257 62..216 322 42.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:20:42
Subject Length Description Subject Range Query Range Score Percent Strand
Nacalpha-PD 217 CG8759-PD 1..217 1..217 1071 100 Plus
Nacalpha-PA 217 CG8759-PA 1..217 1..217 1071 100 Plus
Nacalpha-PC 217 CG8759-PC 1..217 1..217 1071 100 Plus
Nacalpha-PB 217 CG8759-PB 1..217 1..217 1071 100 Plus
CG4415-PB 347 CG4415-PB 145..346 26..216 350 45.1 Plus
CG4415-PA 347 CG4415-PA 145..346 26..216 350 45.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:41:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19746-PA 218 GI19746-PA 1..218 1..217 951 90 Plus
Dmoj\GI17969-PA 230 GI17969-PA 67..226 60..216 313 44.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:41:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10112-PA 215 GL10112-PA 1..215 1..217 918 94.9 Plus
Dper\GL15463-PA 281 GL15463-PA 128..278 68..216 337 49.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:41:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21300-PA 215 GA21300-PA 1..215 1..217 918 94.9 Plus
Dpse\GA18169-PA 277 GA18169-PA 124..274 68..216 335 49.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:41:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20335-PA 217 GM20335-PA 1..217 1..217 1108 99.5 Plus
Dsec\GM16784-PA 338 GM16784-PA 138..337 26..216 385 49 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:41:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25812-PA 217 GD25812-PA 1..217 1..217 1108 99.5 Plus
Dsim\GD23064-PA 317 GD23064-PA 179..316 88..216 300 48.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:41:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18070-PA 218 GJ18070-PA 1..218 1..217 944 92.3 Plus
Dvir\GJ16309-PA 300 GJ16309-PA 131..296 56..216 324 45.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:41:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17972-PA 221 GK17972-PA 1..221 1..217 907 92.8 Plus
Dwil\GK24696-PA 215 GK24696-PA 60..214 67..216 343 49.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:41:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Nacalpha-PA 217 GE13421-PA 1..217 1..217 1091 98.2 Plus
Dyak\GE17266-PA 338 GE17266-PA 140..337 27..216 327 47 Plus