BDGP Sequence Production Resources |
Search the DGRC for GH11984
Library: | GH |
Tissue Source: | Drosophila melanogaster head |
Created by: | Ling Hong |
Date Registered: | 1998-06-02 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 119 |
Well: | 84 |
Vector: | pOT2 |
Associated Gene/Transcript | CG8369-RA |
Protein status: | GH11984.pep: gold |
Preliminary Size: | 423 |
Sequenced Size: | 440 |
Gene | Date | Evidence |
---|---|---|
CG8369 | 2002-01-01 | Sim4 clustering to Release 2 |
CG8369 | 2002-05-18 | Blastp of sequenced clone |
CG8369 | 2003-01-01 | Sim4 clustering to Release 3 |
CG8369 | 2008-04-29 | Release 5.5 accounting |
CG8369 | 2008-08-15 | Release 5.9 accounting |
CG8369 | 2008-12-18 | 5.12 accounting |
440 bp (440 high quality bases) assembled on 2002-05-18
GenBank Submission: AY118777
> GH11984.complete ACTCGAAGCCGGTTTTTGCGAAAGTCAAATCTTTTTTATTCTAGTTGTGA TTTCGTGGAAATTTCGATTATTATTCAAAATGCGTTTCGCTCTGTTTGCT TTTCTAGCACTGTGCTTGCTGGCATTCGTCCTGGCTACTCCGGCCAAGGA CACCAAGAAGCCGGCCACCAACAGTTGCCAGCACAACTGCGGTGAAGTCT ACGAGCCCGTTTGTGCCAAGGCCAAAAACAGCAGCAAGGAGCGCCTCCTC ACCTTTGGCAGCCCGTGCGTCATGGCCAACTACAACTGCCAGCATGCCGA CGATCCATTCGAGCAGAAGTCCAAGGGCGAGTGCGGCGGTGGAGTGAGCG TTCGCCTGTCCTAGAAGTCCAATTTCAACACTTTTGACGATTAAACATCT TTCACTGATTGTGCAATAATAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 4648425..4648625 | 105..305 | 1005 | 100 | Plus |
chr3R | 27901430 | chr3R | 4648683..4648797 | 306..420 | 575 | 100 | Plus |
chr3R | 27901430 | chr3R | 4647978..4648084 | 1..107 | 535 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 4647978..4648084 | 1..107 | 100 | -> | Plus |
chr3R | 4648428..4648625 | 108..305 | 100 | -> | Plus |
chr3R | 4648683..4648797 | 306..420 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8369-RA | 1..285 | 80..364 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8369-RA | 1..285 | 80..364 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8369-RA | 1..285 | 80..364 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8369-RA | 1..285 | 80..364 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8369-RA | 1..285 | 80..364 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8369-RA | 1..420 | 1..420 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8369-RA | 12..431 | 1..420 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8369-RA | 12..431 | 1..420 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8369-RA | 1..420 | 1..420 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG8369-RA | 12..431 | 1..420 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 8822019..8822125 | 1..107 | 100 | -> | Plus |
3R | 8822469..8822666 | 108..305 | 100 | -> | Plus |
3R | 8822724..8822838 | 306..420 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 8822019..8822125 | 1..107 | 100 | -> | Plus |
3R | 8822469..8822666 | 108..305 | 100 | -> | Plus |
3R | 8822724..8822838 | 306..420 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 8822019..8822125 | 1..107 | 100 | -> | Plus |
3R | 8822469..8822666 | 108..305 | 100 | -> | Plus |
3R | 8822724..8822838 | 306..420 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 4647741..4647847 | 1..107 | 100 | -> | Plus |
arm_3R | 4648191..4648388 | 108..305 | 100 | -> | Plus |
arm_3R | 4648446..4648560 | 306..420 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 8562850..8562956 | 1..107 | 100 | -> | Plus |
3R | 8563300..8563497 | 108..305 | 100 | -> | Plus |
3R | 8563555..8563669 | 306..420 | 100 | Plus |
Translation from 1 to 363
> GH11984.hyp LEAGFCESQIFFILVVISWKFRLLFKMRFALFAFLALCLLAFVLATPAKD TKKPATNSCQHNCGEVYEPVCAKAKNSSKERLLTFGSPCVMANYNCQHAD DPFEQKSKGECGGGVSVRLS*
Translation from 79 to 363
> GH11984.pep MRFALFAFLALCLLAFVLATPAKDTKKPATNSCQHNCGEVYEPVCAKAKN SSKERLLTFGSPCVMANYNCQHADDPFEQKSKGECGGGVSVRLS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF18194-PA | 94 | GF18194-PA | 1..94 | 1..94 | 388 | 75.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG13324-PA | 94 | GG13324-PA | 1..94 | 1..94 | 483 | 97.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH23934-PA | 87 | GH23934-PA | 4..87 | 10..94 | 357 | 80 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG8369-PA | 94 | CG8369-PA | 1..94 | 1..94 | 505 | 100 | Plus |
CG8369-PE | 84 | CG8369-PE | 1..84 | 11..94 | 455 | 98.8 | Plus |
CG8369-PD | 84 | CG8369-PD | 1..84 | 11..94 | 455 | 98.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI10053-PA | 93 | GI10053-PA | 1..93 | 1..94 | 404 | 84 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL21551-PA | 93 | GL21551-PA | 21..93 | 21..94 | 338 | 87.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA21026-PA | 93 | GA21026-PA | 20..93 | 20..94 | 338 | 86.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM23768-PA | 94 | GM23768-PA | 1..94 | 1..94 | 489 | 98.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23788-PA | 93 | GJ23788-PA | 1..93 | 1..94 | 410 | 84 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK12185-PA | 92 | GK12185-PA | 1..92 | 1..94 | 404 | 84 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE25912-PA | 94 | GE25912-PA | 1..94 | 1..94 | 487 | 97.9 | Plus |