Clone GH11984 Report

Search the DGRC for GH11984

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:119
Well:84
Vector:pOT2
Associated Gene/TranscriptCG8369-RA
Protein status:GH11984.pep: gold
Preliminary Size:423
Sequenced Size:440

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8369 2002-01-01 Sim4 clustering to Release 2
CG8369 2002-05-18 Blastp of sequenced clone
CG8369 2003-01-01 Sim4 clustering to Release 3
CG8369 2008-04-29 Release 5.5 accounting
CG8369 2008-08-15 Release 5.9 accounting
CG8369 2008-12-18 5.12 accounting

Clone Sequence Records

GH11984.complete Sequence

440 bp (440 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118777

> GH11984.complete
ACTCGAAGCCGGTTTTTGCGAAAGTCAAATCTTTTTTATTCTAGTTGTGA
TTTCGTGGAAATTTCGATTATTATTCAAAATGCGTTTCGCTCTGTTTGCT
TTTCTAGCACTGTGCTTGCTGGCATTCGTCCTGGCTACTCCGGCCAAGGA
CACCAAGAAGCCGGCCACCAACAGTTGCCAGCACAACTGCGGTGAAGTCT
ACGAGCCCGTTTGTGCCAAGGCCAAAAACAGCAGCAAGGAGCGCCTCCTC
ACCTTTGGCAGCCCGTGCGTCATGGCCAACTACAACTGCCAGCATGCCGA
CGATCCATTCGAGCAGAAGTCCAAGGGCGAGTGCGGCGGTGGAGTGAGCG
TTCGCCTGTCCTAGAAGTCCAATTTCAACACTTTTGACGATTAAACATCT
TTCACTGATTGTGCAATAATAAAAAAAAAAAAAAAAAAAA

GH11984.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:11:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG8369-RA 512 CG8369-RA 76..496 1..421 2105 100 Plus
CG9836-RA 1006 CG9836-RA 961..1006 421..376 230 100 Minus
CG9836.c 1018 CG9836.c 973..1018 421..376 230 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:23:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 4648425..4648625 105..305 1005 100 Plus
chr3R 27901430 chr3R 4648683..4648797 306..420 575 100 Plus
chr3R 27901430 chr3R 4647978..4648084 1..107 535 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:45:34 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:23:40
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8822466..8822666 105..305 1005 100 Plus
3R 32079331 3R 8822724..8822839 306..421 580 100 Plus
3R 32079331 3R 8822019..8822125 1..107 535 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:05:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 8563297..8563497 105..305 1005 100 Plus
3R 31820162 3R 8563555..8563670 306..421 580 100 Plus
3R 31820162 3R 8562850..8562956 1..107 535 100 Plus
Blast to na_te.dros performed on 2019-03-15 15:23:40 has no hits.

GH11984.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:24:38 Download gff for GH11984.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 4647978..4648084 1..107 100 -> Plus
chr3R 4648428..4648625 108..305 100 -> Plus
chr3R 4648683..4648797 306..420 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:36:43 Download gff for GH11984.complete
Subject Subject Range Query Range Percent Splice Strand
CG8369-RA 1..285 80..364 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:18:33 Download gff for GH11984.complete
Subject Subject Range Query Range Percent Splice Strand
CG8369-RA 1..285 80..364 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:27:09 Download gff for GH11984.complete
Subject Subject Range Query Range Percent Splice Strand
CG8369-RA 1..285 80..364 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:32:12 Download gff for GH11984.complete
Subject Subject Range Query Range Percent Splice Strand
CG8369-RA 1..285 80..364 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:05:02 Download gff for GH11984.complete
Subject Subject Range Query Range Percent Splice Strand
CG8369-RA 1..285 80..364 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:46:47 Download gff for GH11984.complete
Subject Subject Range Query Range Percent Splice Strand
CG8369-RA 1..420 1..420 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:18:33 Download gff for GH11984.complete
Subject Subject Range Query Range Percent Splice Strand
CG8369-RA 12..431 1..420 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:27:09 Download gff for GH11984.complete
Subject Subject Range Query Range Percent Splice Strand
CG8369-RA 12..431 1..420 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:32:13 Download gff for GH11984.complete
Subject Subject Range Query Range Percent Splice Strand
CG8369-RA 1..420 1..420 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:05:02 Download gff for GH11984.complete
Subject Subject Range Query Range Percent Splice Strand
CG8369-RA 12..431 1..420 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:24:38 Download gff for GH11984.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8822019..8822125 1..107 100 -> Plus
3R 8822469..8822666 108..305 100 -> Plus
3R 8822724..8822838 306..420 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:24:38 Download gff for GH11984.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8822019..8822125 1..107 100 -> Plus
3R 8822469..8822666 108..305 100 -> Plus
3R 8822724..8822838 306..420 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:24:38 Download gff for GH11984.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8822019..8822125 1..107 100 -> Plus
3R 8822469..8822666 108..305 100 -> Plus
3R 8822724..8822838 306..420 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:27:09 Download gff for GH11984.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4647741..4647847 1..107 100 -> Plus
arm_3R 4648191..4648388 108..305 100 -> Plus
arm_3R 4648446..4648560 306..420 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:48:11 Download gff for GH11984.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8562850..8562956 1..107 100 -> Plus
3R 8563300..8563497 108..305 100 -> Plus
3R 8563555..8563669 306..420 100   Plus

GH11984.hyp Sequence

Translation from 1 to 363

> GH11984.hyp
LEAGFCESQIFFILVVISWKFRLLFKMRFALFAFLALCLLAFVLATPAKD
TKKPATNSCQHNCGEVYEPVCAKAKNSSKERLLTFGSPCVMANYNCQHAD
DPFEQKSKGECGGGVSVRLS*

GH11984.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:26:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG8369-PA 94 CG8369-PA 1..94 27..120 505 100 Plus
CG8369-PC 30 CG8369-PC 1..30 91..120 166 100 Plus
CG8369-PB 30 CG8369-PB 1..30 91..120 166 100 Plus

GH11984.pep Sequence

Translation from 79 to 363

> GH11984.pep
MRFALFAFLALCLLAFVLATPAKDTKKPATNSCQHNCGEVYEPVCAKAKN
SSKERLLTFGSPCVMANYNCQHADDPFEQKSKGECGGGVSVRLS*

GH11984.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:04:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18194-PA 94 GF18194-PA 1..94 1..94 388 75.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:04:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13324-PA 94 GG13324-PA 1..94 1..94 483 97.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:04:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23934-PA 87 GH23934-PA 4..87 10..94 357 80 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:05:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG8369-PA 94 CG8369-PA 1..94 1..94 505 100 Plus
CG8369-PE 84 CG8369-PE 1..84 11..94 455 98.8 Plus
CG8369-PD 84 CG8369-PD 1..84 11..94 455 98.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:04:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10053-PA 93 GI10053-PA 1..93 1..94 404 84 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:04:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21551-PA 93 GL21551-PA 21..93 21..94 338 87.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:04:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21026-PA 93 GA21026-PA 20..93 20..94 338 86.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:04:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23768-PA 94 GM23768-PA 1..94 1..94 489 98.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:04:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23788-PA 93 GJ23788-PA 1..93 1..94 410 84 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:04:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12185-PA 92 GK12185-PA 1..92 1..94 404 84 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:04:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25912-PA 94 GE25912-PA 1..94 1..94 487 97.9 Plus