Clone GH12029 Report

Search the DGRC for GH12029

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:120
Well:29
Vector:pOT2
Associated Gene/Transcriptbol-RE
Protein status:GH12029.pep: gold
Sequenced Size:1449

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4760 2003-01-01 Sim4 clustering to Release 3
CG4760 2004-01-20 Blastp of sequenced clone
bol 2008-04-29 Release 5.5 accounting
bol 2008-08-15 Release 5.9 accounting
bol 2008-12-18 5.12 accounting

Clone Sequence Records

GH12029.complete Sequence

1449 bp (1449 high quality bases) assembled on 2004-01-20

GenBank Submission: BT011495

> GH12029.complete
AACACTTCTCGATTTCGGGTTTTCGGAATTATAAAAAATAACAGAAATCC
GCCGTTGCCGCCGCTCTCCGCTTATTTTCGGCCAAAATACACAACTCTCG
CGTCGCACGTAAAATCCCAATTGTTAAGTTTGAACAACGGCGAAAAGCAA
AAGCAATCCAGCCAATAAGTGAATCAAAGTCAAAAACGTGAAAAATCACA
TCGAGCGGAAAGTTTTAAACTTGATTTTTATTTCGTCTGCCTGCTGCAAA
CGAGGCAAGGAAAACAGAAAAGAGCTAGAAGTACATCCAACGGTATACAT
GCGTGCTACAAGTAAATCAGTGAAAGACATCTCAATAGCCCCAGCCGTCG
CATAACCGTCATCCAATCCGATCCGATCCGGTCCGATCCGATTCGATTTG
AGCTGATCTAAAACAACAACCTCCGCCGTAACCAAAAAGGAAACAAATAG
CAAAACACCGGAGCCGCTCGATCCAGCGAACGGCAGCGACAAGAAGTTTT
TTTCGGCCAGCGCGCACCCCCAAACTCCAGAAACAGCCTCAAGATTCTGC
CCTTCGGAGCACCCAACTTTCGTCTGGAGACGACACCCGCAGAGATGCAC
AAAATAGCAGCAGCGCCGCCTCCATCGGCAACGCCCGGCGGAGGACTGGA
GACGCCCCTGGCGGCGCCAAAATACGGCACACTAATACCCAATCGCATCT
TTGTGGGTGGCATCAGCGGCGATACCACCGAGGCTGATCTAACCCGCGTC
TTCAGCGCCTATGGCACGGTAAAGAGCACCAAAATCATCGTGGATCGAGC
AGGTGTGAGCAAGGGCTACGGATTCGTCACCTTCGAGACGGAGCAGGAGG
CGCAAAGACTGCAAGCGGATGGCATTACCTGACCCATCACACACAAGTAC
TACTACTACTATGAGACGTCGGTTCCTCCTACTACTACCGATACCACTAC
TACTACTACTACTACTACCAACAACACTCCCCGCGGGGGGGTCCCCACAT
AAGAAATAACTCATATGATTGTCGCCACTGTGCGATATATGAGATATATG
ATGATCTTGATTGATGTACCGCCTTAGGGTGAATGCGTGGTACTAAGAGA
TCGGAAGCTGAACATTGCACCGGCCATCAAAAAGCAGCCCAATCCTCTGC
AGTCAATTGTGGCCACAAACGGAGCCGTCTACTATACCACCACGCCGCCG
GCACCGATCAGCAATATACCCATGGATCAGTTCGCAGCCGCTGTATATCC
GCCAGTTACTGACTTTACAGCCGCTGGAGTGCCAGCCATCTACCCACCTT
CAGCCATGCAATATCAGCCATTCTATCAGTACTACAGTGTGCCAATGAAT
GTACCCACCATTTGGCCTCAGAACTACCAAGGTTAAATCCGAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

GH12029.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:06:55
Subject Length Description Subject Range Query Range Score Percent Strand
bol.l 1933 bol.l 29..1432 1..1404 7005 99.9 Plus
bol-RE 1421 bol-RE 29..1421 1..1393 6965 100 Plus
bol.g 5359 bol.g 42..913 1..872 4360 100 Plus
bol.g 5359 bol.g 912..1089 1078..1255 890 100 Plus
bol.g 5359 bol.g 1087..1223 1268..1404 670 99.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:01:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 9104931..9105363 716..273 1985 97.5 Minus
chr3L 24539361 chr3L 9104068..9104267 1078..882 875 97 Minus
chr3L 24539361 chr3L 9115478..9115638 274..114 805 100 Minus
chr3L 24539361 chr3L 9104528..9104684 871..715 770 99.4 Minus
chr3L 24539361 chr3L 9099890..9100010 1255..1135 605 100 Minus
chr3L 24539361 chr3L 9117015..9117127 113..1 565 100 Minus
chr3L 24539361 chr3L 9099553..9099646 1347..1254 470 100 Minus
chr3L 24539361 chr3L 9100066..9100128 1137..1075 315 100 Minus
chr3L 24539361 chr3L 9099270..9099306 1383..1347 185 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:45:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:01:57
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9113046..9113489 716..273 2220 100 Minus
3L 28110227 3L 9112161..9112368 1078..871 1040 100 Minus
3L 28110227 3L 9123616..9123776 274..114 805 100 Minus
3L 28110227 3L 9112633..9112789 871..715 785 100 Minus
3L 28110227 3L 9107956..9108076 1255..1135 605 100 Minus
3L 28110227 3L 9125167..9125279 113..1 565 100 Minus
3L 28110227 3L 9107619..9107712 1347..1254 470 100 Minus
3L 28110227 3L 9108132..9108194 1137..1075 315 100 Minus
3L 28110227 3L 9107340..9107376 1383..1347 185 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:53:03
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 9106146..9106589 716..273 2220 100 Minus
3L 28103327 3L 9105261..9105468 1078..871 1040 100 Minus
3L 28103327 3L 9116716..9116876 274..114 805 100 Minus
3L 28103327 3L 9105733..9105889 871..715 785 100 Minus
3L 28103327 3L 9101056..9101176 1255..1135 605 100 Minus
3L 28103327 3L 9118267..9118379 113..1 565 100 Minus
3L 28103327 3L 9100719..9100812 1347..1254 470 100 Minus
3L 28103327 3L 9101232..9101294 1137..1075 315 100 Minus
3L 28103327 3L 9100440..9100476 1383..1347 185 100 Minus
Blast to na_te.dros performed on 2019-03-15 12:01:58 has no hits.

GH12029.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:02:37 Download gff for GH12029.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 9104931..9105361 275..716 90 <- Minus
chr3L 9099553..9099644 1256..1347 100 <- Minus
chr3L 9099890..9100007 1138..1255 100 <- Minus
chr3L 9100066..9100125 1078..1137 100 <- Minus
chr3L 9104069..9104281 871..1077 78 <- Minus
chr3L 9104529..9104682 717..870 99 <- Minus
chr3L 9115478..9115638 114..274 100 <- Minus
chr3L 9117015..9117127 1..113 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:32:00 Download gff for GH12029.complete
Subject Subject Range Query Range Percent Splice Strand
bol-RB 1..278 595..872 100 == Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:41:20 Download gff for GH12029.complete
Subject Subject Range Query Range Percent Splice Strand
bol-RB 1..278 595..872 100 == Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:36:26 Download gff for GH12029.complete
Subject Subject Range Query Range Percent Splice Strand
bol-RF 1..276 595..870 100 == Plus
bol-RF 277..586 1078..1390 98   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:30:10 Download gff for GH12029.complete
Subject Subject Range Query Range Percent Splice Strand
bol-RB 1..278 595..872 100 == Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:49:55 Download gff for GH12029.complete
Subject Subject Range Query Range Percent Splice Strand
bol-RF 1..276 595..870 100 == Plus
bol-RF 277..586 1078..1390 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:32:00 Download gff for GH12029.complete
Subject Subject Range Query Range Percent Splice Strand
bol-RE 1..1391 1..1391 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:41:19 Download gff for GH12029.complete
Subject Subject Range Query Range Percent Splice Strand
bol-RE 1..1391 1..1391 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:36:26 Download gff for GH12029.complete
Subject Subject Range Query Range Percent Splice Strand
bol-RE 35..1425 1..1391 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:30:10 Download gff for GH12029.complete
Subject Subject Range Query Range Percent Splice Strand
bol-RD 17..888 1..872 100 == Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:49:55 Download gff for GH12029.complete
Subject Subject Range Query Range Percent Splice Strand
bol-RE 35..1425 1..1391 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:02:37 Download gff for GH12029.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9112634..9112787 717..870 100 <- Minus
3L 9107619..9107710 1256..1347 100 <- Minus
3L 9107956..9108073 1138..1255 100 <- Minus
3L 9108132..9108191 1078..1137 100 <- Minus
3L 9112162..9112368 871..1077 100 <- Minus
3L 9113046..9113487 275..716 100 <- Minus
3L 9123616..9123776 114..274 100 <- Minus
3L 9125167..9125279 1..113 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:02:37 Download gff for GH12029.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9112634..9112787 717..870 100 <- Minus
3L 9107619..9107710 1256..1347 100 <- Minus
3L 9107956..9108073 1138..1255 100 <- Minus
3L 9108132..9108191 1078..1137 100 <- Minus
3L 9112162..9112368 871..1077 100 <- Minus
3L 9113046..9113487 275..716 100 <- Minus
3L 9123616..9123776 114..274 100 <- Minus
3L 9125167..9125279 1..113 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:02:37 Download gff for GH12029.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9112634..9112787 717..870 100 <- Minus
3L 9107619..9107710 1256..1347 100 <- Minus
3L 9107956..9108073 1138..1255 100 <- Minus
3L 9108132..9108191 1078..1137 100 <- Minus
3L 9112162..9112368 871..1077 100 <- Minus
3L 9113046..9113487 275..716 100 <- Minus
3L 9123616..9123776 114..274 100 <- Minus
3L 9125167..9125279 1..113 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:36:26 Download gff for GH12029.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9100719..9100810 1256..1347 100 <- Minus
arm_3L 9101056..9101173 1138..1255 100 <- Minus
arm_3L 9101232..9101291 1078..1137 100 <- Minus
arm_3L 9105262..9105468 871..1077 100 <- Minus
arm_3L 9105734..9105887 717..870 100 <- Minus
arm_3L 9106146..9106587 275..716 100 <- Minus
arm_3L 9116716..9116876 114..274 100 <- Minus
arm_3L 9118267..9118379 1..113 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:02:37 Download gff for GH12029.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9106146..9106587 275..716 100 <- Minus
3L 9116716..9116876 114..274 100 <- Minus
3L 9118267..9118379 1..113 100   Minus
3L 9100719..9100810 1256..1347 100 <- Minus
3L 9101056..9101173 1138..1255 100 <- Minus
3L 9101232..9101291 1078..1137 100 <- Minus
3L 9105262..9105468 871..1077 100 <- Minus
3L 9105734..9105887 717..870 100 <- Minus

GH12029.hyp Sequence

Translation from 594 to 881

> GH12029.hyp
MHKIAAAPPPSATPGGGLETPLAAPKYGTLIPNRIFVGGISGDTTEADLT
RVFSAYGTVKSTKIIVDRAGVSKGYGFVTFETEQEAQRLQADGIT*

GH12029.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:27:33
Subject Length Description Subject Range Query Range Score Percent Strand
bol-PE 95 CG4760-PE 1..95 1..95 485 100 Plus
bol-PA 189 CG4760-PA 1..93 1..93 476 100 Plus
bol-PC 189 CG4760-PC 1..93 1..93 476 100 Plus
bol-PG 228 CG4760-PG 1..93 1..93 476 100 Plus
bol-PD 228 CG4760-PD 1..93 1..93 476 100 Plus

GH12029.pep Sequence

Translation from 594 to 881

> GH12029.pep
MHKIAAAPPPSATPGGGLETPLAAPKYGTLIPNRIFVGGISGDTTEADLT
RVFSAYGTVKSTKIIVDRAGVSKGYGFVTFETEQEAQRLQADGIT*

GH12029.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:41:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23585-PA 235 GF23585-PA 1..93 1..93 369 93.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:41:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15038-PA 233 GG15038-PA 1..93 1..93 479 98.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:41:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15900-PA 233 GH15900-PA 1..93 1..93 400 89.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:41:17
Subject Length Description Subject Range Query Range Score Percent Strand
bol-PE 95 CG4760-PE 1..95 1..95 485 100 Plus
bol-PA 189 CG4760-PA 1..93 1..93 476 100 Plus
bol-PC 189 CG4760-PC 1..93 1..93 476 100 Plus
bol-PG 228 CG4760-PG 1..93 1..93 476 100 Plus
bol-PD 228 CG4760-PD 1..93 1..93 476 100 Plus
bol-PB 228 CG4760-PB 1..93 1..93 476 100 Plus
bol-PF 233 CG4760-PF 1..93 1..93 476 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:41:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16553-PA 231 GI16553-PA 1..93 1..93 395 91.4 Plus
Dmoj\GI15726-PA 265 GI15726-PA 15..110 1..93 295 62.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:41:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15077-PA 113 GL15077-PA 1..69 1..70 314 91.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:41:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18412-PA 190 GA18412-PA 1..92 1..93 433 92.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:41:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24891-PA 228 GM24891-PA 1..93 1..93 479 98.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:41:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12804-PA 231 GJ12804-PA 1..93 1..93 395 90.3 Plus
Dvir\GJ15254-PA 341 GJ15254-PA 107..199 1..93 305 64.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:41:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24376-PA 277 GK24376-PA 1..93 1..93 366 87.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:41:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21261-PA 228 GE21261-PA 1..93 1..93 483 100 Plus