Clone GH12334 Report

Search the DGRC for GH12334

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:123
Well:34
Vector:pOT2
Associated Gene/Transcripteap-RA
Protein status:GH12334.pep: gold
Preliminary Size:1320
Sequenced Size:1104

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6827 2001-01-01 Release 2 assignment
CG32099 2002-03-19 Blastp of sequenced clone
CG32099 2003-01-01 Sim4 clustering to Release 3
eap 2008-04-29 Release 5.5 accounting
eap 2008-08-15 Release 5.9 accounting
eap 2008-12-18 5.12 accounting

Clone Sequence Records

GH12334.complete Sequence

1104 bp (1104 high quality bases) assembled on 2002-03-19

GenBank Submission: AY094706

> GH12334.complete
ATCACAATAGCGAATTAAAAACAACATTGCAAAGCGAAAACGCCCTGAAA
ACAATGATTATAAAAGCAATTAGATAGTTACAAAACGCATTGAAATGAGC
AAACACATCTGCACCCGCTGGGCCTTTGACCTGGGCAGCTGGAGGCCCAC
ACTACCTCAACTGAGCCAGGCGGTGGCCTCAATTCAACCGGAGGAACGAG
CTCGGCTTATGAAGTTCCACTTTATCGATGACTTTCTGTCCTCGCTAATT
GGTCGTCTTTTCATGCGAAAATATGTGAGCACGTGCAGCGGATTGCCGTC
GGCCGAAGTGAAGTTCGCCCGGGATGTGAGGGGTAAACCTTACTGGGTGA
AAGGGGAGGACTACGATGGGCCACCTCTCAGCTTCAATGTCTCCCATCAG
GGAAGCCTGGTACTTCTAGCGGGCATTGCAGGAGAGAGCAGTGATCCCGA
CTTTGGAATCGGCACAGATGTCATGAAGATCGAGTACAATGGTGGCAAGC
CTCTGTCGGAATTCTTTGGCCTGATGAAGAGCAAATTTTCGGCGGAGGAA
TGGAGTTATATTGGAAGACCGCATCATGATGAACGGGAGCAGGTGAAGGC
CTTTATGCGTCACTGGTGTCTCAAGGAGGCGTACGTCAAGGAGCTGGGTG
TTGGCATCACTGTAGATCTGCAAAAGATCAGCTTCTCAGTGGACACTACT
CGCAGTTTGGAGACAGATGTTTCCCCTCTGATCGGTACTAGTCTGCGTTG
CCACGACCAACCCATGGACAATTGGCATTTCGAGGAGCATTTACTGCAGG
AGGACTACTGTGCGGCCATTGCATTCCGGAATTGCTTGCCACAGGAGCGT
GGAAAGTTCAAGTTTCTGCAAGTTGAGGAACTTCTCGTGAAGAGTGAAGA
TTCGGAACTTGAGGAAGTGATCAGCTACTGCCAAAAGGCTCTTCTTAAGC
CCTACAAGCGATCATGATGTATAGGAACTATAAGGAATCTAAGCCAAGCA
AACGTAGCTCCTAAAAATAGCGTTATCCCTAGAATAAACATGCATTTATA
TTTTCTCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAA

GH12334.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:22:21
Subject Length Description Subject Range Query Range Score Percent Strand
eap-RA 1061 eap-RA 1..1059 1..1059 5295 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:49:58
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 12140031..12141087 1..1057 5285 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:46:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:49:56
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 12149273..12150331 1..1059 5295 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:51:46
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 12142373..12143431 1..1059 5295 100 Plus
Blast to na_te.dros performed on 2019-03-16 02:49:57 has no hits.

GH12334.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:50:43 Download gff for GH12334.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 12140031..12141087 1..1057 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:37:34 Download gff for GH12334.complete
Subject Subject Range Query Range Percent Splice Strand
eap-RA 1..873 95..967 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:31:12 Download gff for GH12334.complete
Subject Subject Range Query Range Percent Splice Strand
eap-RA 1..873 95..967 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:14:55 Download gff for GH12334.complete
Subject Subject Range Query Range Percent Splice Strand
eap-RA 1..873 95..967 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:04:31 Download gff for GH12334.complete
Subject Subject Range Query Range Percent Splice Strand
eap-RA 1..873 95..967 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:22:53 Download gff for GH12334.complete
Subject Subject Range Query Range Percent Splice Strand
eap-RA 1..873 95..967 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:57:17 Download gff for GH12334.complete
Subject Subject Range Query Range Percent Splice Strand
eap-RA 1..1057 1..1057 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:31:12 Download gff for GH12334.complete
Subject Subject Range Query Range Percent Splice Strand
eap-RA 1..1057 1..1057 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:14:55 Download gff for GH12334.complete
Subject Subject Range Query Range Percent Splice Strand
eap-RA 1..1057 1..1057 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:04:31 Download gff for GH12334.complete
Subject Subject Range Query Range Percent Splice Strand
eap-RA 1..1057 1..1057 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:22:53 Download gff for GH12334.complete
Subject Subject Range Query Range Percent Splice Strand
eap-RA 1..1057 1..1057 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:50:43 Download gff for GH12334.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12149273..12150329 1..1057 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:50:43 Download gff for GH12334.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12149273..12150329 1..1057 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:50:43 Download gff for GH12334.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12149273..12150329 1..1057 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:14:55 Download gff for GH12334.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 12142373..12143429 1..1057 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:38:17 Download gff for GH12334.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12142373..12143429 1..1057 100   Plus

GH12334.pep Sequence

Translation from 94 to 966

> GH12334.pep
MSKHICTRWAFDLGSWRPTLPQLSQAVASIQPEERARLMKFHFIDDFLSS
LIGRLFMRKYVSTCSGLPSAEVKFARDVRGKPYWVKGEDYDGPPLSFNVS
HQGSLVLLAGIAGESSDPDFGIGTDVMKIEYNGGKPLSEFFGLMKSKFSA
EEWSYIGRPHHDEREQVKAFMRHWCLKEAYVKELGVGITVDLQKISFSVD
TTRSLETDVSPLIGTSLRCHDQPMDNWHFEEHLLQEDYCAAIAFRNCLPQ
ERGKFKFLQVEELLVKSEDSELEEVISYCQKALLKPYKRS*

GH12334.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:40:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG32099-PA 290 CG32099-PA 1..290 1..290 1543 100 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:28:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16677-PB 303 GA16677-PB 1..300 1..288 1166 73.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:28:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25331-PA 1561 GM25331-PA 74..273 71..270 1007 92.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:29:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12320-PA 293 GJ12320-PA 1..291 1..289 1149 72.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:29:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25462-PA 1603 GK25462-PA 77..334 14..241 744 59.8 Plus

GH12334.hyp Sequence

Translation from 94 to 966

> GH12334.hyp
MSKHICTRWAFDLGSWRPTLPQLSQAVASIQPEERARLMKFHFIDDFLSS
LIGRLFMRKYVSTCSGLPSAEVKFARDVRGKPYWVKGEDYDGPPLSFNVS
HQGSLVLLAGIAGESSDPDFGIGTDVMKIEYNGGKPLSEFFGLMKSKFSA
EEWSYIGRPHHDEREQVKAFMRHWCLKEAYVKELGVGITVDLQKISFSVD
TTRSLETDVSPLIGTSLRCHDQPMDNWHFEEHLLQEDYCAAIAFRNCLPQ
ERGKFKFLQVEELLVKSEDSELEEVISYCQKALLKPYKRS*

GH12334.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:30:26
Subject Length Description Subject Range Query Range Score Percent Strand
eap-PA 290 CG32099-PA 1..290 1..290 1543 100 Plus