Clone GH12380 Report

Search the DGRC for GH12380

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:123
Well:80
Vector:pOT2
Associated Gene/TranscriptCG40486-RA
Protein status:GH12380.pep: wuzgold
Preliminary Size:927
Sequenced Size:1221

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12466 2001-01-01 Release 2 assignment
CG40486 2008-04-29 Release 5.5 accounting
CG40486 2008-08-15 Release 5.9 accounting
CG40486 2008-12-18 5.12 accounting

Clone Sequence Records

GH12380.complete Sequence

1221 bp (1221 high quality bases) assembled on 2001-07-04

GenBank Submission: AY060282

> GH12380.complete
AGAACTGCCTAGGAGCTGGGCCTGGAAGAATACTTACTAACAACCAAAAT
ACTCAAAGAGAACCTGGCTTGGGAGGCACAGCATTCGTAATACTCATCGA
GAATCTTAGGGATGGAACGCTGGCATGATCGCGTGGCTGTGGTCACGGGT
GCCAGCTCCGGGATAGGAGCTGCAGTGGCACGCCACTTGGTGAGTGCAGG
GGTCATTGTTGTAGGTCTGGCCCGTCGGGTCGACCGCATGAAGGCTATCA
AGGAACAACTGCCGCCGGAGCTGCAGGGCCGCCTGCATGCCATCCACTGC
GATGTCGAAGATCTGGACTCGGTGACGGCTGCCTTTGACTGGATCGAGGA
GCAGCTCGGCGGATGTGACATCCTGGTGAACAACGCGGGATGCCTGAACC
CCGGACAACTTCTCACCCTGGAGCTAGAGCAGCTGCAGCAGGTCCTGAAC
GTGAACTTGATGGGCGTGGTCATCTGCACCCGCCGCGCCTTTCGCTCAAT
GCAGCAACGCGAGGTGGATGGCCATGTGATCCTCATTAACAGCCTAACGG
GCCGTAACATCATCAATCCACCTGGTGACGAGCTGCAGGTGCTCAACATG
TATCCGCTTACCAAGCACGGGGTTACGGCCATGTTGGAAGTCCTGCGACA
GGAGCTGCGCGGATTCAAGACTAAGATAAAGGTCACAGTGAGTGCACAAA
AATCGATCAAATAGTATATATATGTCCGTCCGTATCAACTTCGAGATTTC
AGAAACTATAAAAGCTGGTTAAGATTAAGCGTGCAGATTCAAGAGTAATA
GACGTCACGGAACGTTCTTCGTTGTATTGTTTTTCTTGCCAATTATTAAG
TTCAAAGTATTAATTTACGTCGCATTTTTAGCTGAGTAACGAGTATCAAC
TAAGGAAGTGAACTCTTTTATAACCGACAAGTCTACAAGCTGTTTATCTC
CTGTTTTTTCTAGAGCATCACTCCAGGTGTGACCGATACGGAGATTCTGC
CCTCCGGCTACGGTATTTTGCCGATGCTAAAACCGGATGACATTGCCGCA
GGCATCATGTACGTGCTCGGCACACCCGCACATGTCCAGGTGCACGAGCT
GACCATTAAGCCGTTAGGAGAGCCTTTCTAAGTCCGTCCCGAAATGTCAT
TACGATAATGATAAAAAGACCGTGCGCAGCCAATAAAGTGACTGAAATTG
GGTAAAAAAAAAAAAAAAAAA

GH12380.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:36:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG40486-RA 1203 CG40486-RA 1..1203 1..1203 6015 100 Plus
CG40486-RB 1081 CG40486-RB 20..706 1..687 3435 100 Plus
CG40486.a 1570 CG40486.a 15..701 1..687 3435 100 Plus
CG40486-RB 1081 CG40486-RB 707..947 964..1204 1205 100 Plus
CG40486.a 1570 CG40486.a 702..942 964..1204 1205 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:33:24
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 22354927..22356129 1203..1 6015 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:46:32 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:33:22
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 22958873..22960076 1204..1 6020 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:58:23
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 22943965..22945168 1204..1 6020 100 Minus
3L 28103327 3L 23028460..23028536 795..723 210 87 Minus
4 1331231 4 1004768..1004849 794..717 190 84.1 Minus
2L 23513712 2L 21625123..21625189 795..730 190 88 Minus
Blast to na_te.dros performed 2019-03-16 03:33:23
Subject Length Description Subject Range Query Range Score Percent Strand
INE-1 611 INE-1 INE1 611bp Derived from U66884 (e1371475) (Rel. 52, Last updated, Version 6). 123..201 718..792 224 78.5 Plus
Dbuz\ISBu2 726 Dbuz\ISBu2 ISBU2 726bp 166..210 724..768 171 86.7 Plus
diver 6112 diver Tinker 6112bp 1330..1386 23..75 122 73.7 Plus

GH12380.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:34:15 Download gff for GH12380.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 22354927..22355317 813..1203 100 == Minus
chrX 22355413..22356129 1..717 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:37:42 Download gff for GH12380.complete
Subject Subject Range Query Range Percent Splice Strand
CG40486-RA 1..603 112..714 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:27:43 Download gff for GH12380.complete
Subject Subject Range Query Range Percent Splice Strand
CG40486-RA 1..603 112..714 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:59:44 Download gff for GH12380.complete
Subject Subject Range Query Range Percent Splice Strand
CG40486-RA 1..603 112..714 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:01:00 Download gff for GH12380.complete
Subject Subject Range Query Range Percent Splice Strand
CG40486-RA 1..603 112..714 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:08:39 Download gff for GH12380.complete
Subject Subject Range Query Range Percent Splice Strand
CG40486-RB 1..576 112..687 100 == Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:27:21 Download gff for GH12380.complete
Subject Subject Range Query Range Percent Splice Strand
CG40486-RA 1..1203 1..1203 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:27:43 Download gff for GH12380.complete
Subject Subject Range Query Range Percent Splice Strand
CG40486-RA 1..1201 1..1201 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:59:44 Download gff for GH12380.complete
Subject Subject Range Query Range Percent Splice Strand
CG40486-RA 1..1201 1..1201 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:01:00 Download gff for GH12380.complete
Subject Subject Range Query Range Percent Splice Strand
CG40486-RA 1..1203 1..1203 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:08:39 Download gff for GH12380.complete
Subject Subject Range Query Range Percent Splice Strand
CG40486-RB 16..702 1..687 100 == Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:34:15 Download gff for GH12380.complete
Subject Subject Range Query Range Percent Splice Strand
X 22958874..22960076 1..1203 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:34:15 Download gff for GH12380.complete
Subject Subject Range Query Range Percent Splice Strand
X 22958874..22960076 1..1203 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:34:15 Download gff for GH12380.complete
Subject Subject Range Query Range Percent Splice Strand
X 22958874..22960076 1..1203 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:59:44 Download gff for GH12380.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 22360710..22361912 1..1203 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:38:52 Download gff for GH12380.complete
Subject Subject Range Query Range Percent Splice Strand
X 22943966..22945168 1..1203 100   Minus

GH12380.pep Sequence

Translation from 111 to 713

> GH12380.pep
MERWHDRVAVVTGASSGIGAAVARHLVSAGVIVVGLARRVDRMKAIKEQL
PPELQGRLHAIHCDVEDLDSVTAAFDWIEEQLGGCDILVNNAGCLNPGQL
LTLELEQLQQVLNVNLMGVVICTRRAFRSMQQREVDGHVILINSLTGRNI
INPPGDELQVLNMYPLTKHGVTAMLEVLRQELRGFKTKIKVTVSAQKSIK
*

GH12380.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:09:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22157-PA 250 GF22157-PA 1..192 1..192 847 81.2 Plus
Dana\GF22156-PA 248 GF22156-PA 1..193 1..192 604 60.8 Plus
Dana\GF22361-PA 250 GF22361-PA 1..192 1..192 543 55.2 Plus
Dana\GF19119-PA 249 GF19119-PA 1..191 1..192 483 50.8 Plus
Dana\GF10960-PA 252 GF10960-PA 1..192 1..192 477 48.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:09:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17506-PA 247 GG17506-PA 1..192 1..192 908 95.8 Plus
Dere\GG17505-PA 247 GG17505-PA 1..192 1..192 607 58.5 Plus
Dere\GG18873-PA 250 GG18873-PA 1..192 1..192 551 54.7 Plus
Dere\GG10137-PA 251 GG10137-PA 1..192 1..192 469 47.2 Plus
Dere\GG13756-PA 252 GG13756-PA 1..192 1..192 469 47.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:09:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12862-PA 247 GH12862-PA 1..192 1..192 599 57.8 Plus
Dgri\GH12229-PA 250 GH12229-PA 1..192 1..192 557 54.7 Plus
Dgri\GH12228-PA 247 GH12228-PA 1..192 1..192 540 53.6 Plus
Dgri\GH12070-PA 249 GH12070-PA 1..191 1..192 484 51 Plus
Dgri\GH10934-PA 251 GH10934-PA 1..192 1..192 475 47.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG40486-PC 247 CG40486-PC 1..192 1..192 979 100 Plus
CG40486-PB 247 CG40486-PB 1..192 1..192 979 100 Plus
CG40485-PA 231 CG40485-PA 1..194 1..194 604 59.3 Plus
CG40485-PC 247 CG40485-PC 1..192 1..192 596 58.9 Plus
CG40485-PB 247 CG40485-PB 1..192 1..192 596 58.9 Plus
antdh-PA 250 CG1386-PA 1..192 1..192 543 54.7 Plus
CG9360-PA 251 CG9360-PA 1..192 1..192 457 49.2 Plus
CG9150-PB 251 CG9150-PB 1..192 1..192 456 47.7 Plus
CG8757-PB 252 CG8757-PB 1..192 1..192 453 47.7 Plus
CG10962-PB 249 CG10962-PB 1..191 1..192 448 48.7 Plus
CG3301-PC 250 CG3301-PC 1..190 1..189 414 47.7 Plus
CG3301-PB 250 CG3301-PB 1..190 1..189 414 47.7 Plus
CG3301-PA 250 CG3301-PA 1..190 1..189 414 47.7 Plus
rdhB-PB 248 CG7077-PB 7..190 4..192 351 37 Plus
rdhB-PA 248 CG7077-PA 7..190 4..192 351 37 Plus
CG3699-PA 251 CG3699-PA 5..139 6..147 185 34.3 Plus
firl-PE 318 CG14946-PE 57..235 8..192 182 30.5 Plus
firl-PC 318 CG14946-PC 57..235 8..192 182 30.5 Plus
firl-PD 318 CG14946-PD 57..235 8..192 182 30.5 Plus
CG31549-PB 257 CG31549-PB 1..145 1..147 169 30.5 Plus
CG31549-PA 257 CG31549-PA 1..145 1..147 169 30.5 Plus
CG31548-PA 256 CG31548-PA 6..172 7..182 164 28.4 Plus
CG31937-PA 321 CG31937-PA 47..222 7..183 158 28.4 Plus
CG12171-PA 257 CG12171-PA 1..145 1..147 157 27.9 Plus
CG3603-PB 249 CG3603-PB 9..183 7..189 152 29.2 Plus
CG3603-PA 249 CG3603-PA 9..183 7..189 152 29.2 Plus
CG7601-PA 326 CG7601-PA 54..224 7..182 151 27 Plus
CG13833-PA 321 CG13833-PA 54..220 8..182 147 28 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:09:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14956-PA 247 GI14956-PA 1..192 1..192 731 71.9 Plus
Dmoj\GI14955-PA 247 GI14955-PA 1..192 1..192 617 58.3 Plus
Dmoj\GI15762-PA 250 GI15762-PA 1..192 1..192 560 55.7 Plus
Dmoj\GI13477-PA 251 GI13477-PA 1..192 1..192 485 48.2 Plus
Dmoj\GI15562-PA 270 GI15562-PA 1..191 1..192 473 50 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:09:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16539-PA 247 GL16539-PA 1..192 1..192 817 78.1 Plus
Dper\GL16537-PA 294 GL16537-PA 52..239 1..192 589 63.2 Plus
Dper\GL20303-PA 249 GL20303-PA 1..192 1..192 531 52.6 Plus
Dper\GL19078-PA 251 GL19078-PA 1..192 1..192 460 45.6 Plus
Dper\GL13028-PA 249 GL13028-PA 1..191 1..192 452 47.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:09:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23088-PA 247 GA23088-PA 1..192 1..192 816 78.1 Plus
Dpse\GA23087-PA 294 GA23087-PA 52..239 1..192 586 63.2 Plus
Dpse\GA12578-PA 249 GA12578-PA 1..192 1..192 524 52.1 Plus
Dpse\GA22691-PA 279 GA22691-PA 28..219 1..192 464 47.2 Plus
Dpse\GA21577-PA 251 GA21577-PA 1..192 1..192 458 45.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:09:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10056-PA 247 GM10056-PA 1..192 1..192 976 96.4 Plus
Dsec\GM11256-PA 250 GM11256-PA 1..192 1..192 551 53.6 Plus
Dsec\GM13047-PA 251 GM13047-PA 1..192 1..192 471 49.7 Plus
Dsec\GM24579-PA 252 GM24579-PA 1..192 1..192 467 47.2 Plus
Dsec\GM17962-PA 251 GM17962-PA 1..192 1..192 463 47.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:09:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23342-PA 247 GD23342-PA 1..192 1..192 610 60.6 Plus
Dsim\GD15999-PA 250 GD15999-PA 1..192 1..192 552 54.2 Plus
Dsim\GD15972-PA 251 GD15972-PA 1..192 1..192 470 49.7 Plus
Dsim\GD22600-PA 251 GD22600-PA 1..192 1..192 463 47.2 Plus
Dsim\GD16091-PA 249 GD16091-PA 1..191 1..192 463 48.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:09:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18924-PA 247 GJ18924-PA 1..192 1..192 730 71.9 Plus
Dvir\GJ18923-PA 247 GJ18923-PA 1..192 1..192 586 56.2 Plus
Dvir\GJ18619-PA 250 GJ18619-PA 1..192 1..192 559 55.7 Plus
Dvir\GJ15175-PA 249 GJ15175-PA 1..191 1..192 481 50 Plus
Dvir\GJ12118-PA 251 GJ12118-PA 1..192 1..192 471 47.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:09:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20029-PA 264 GK20029-PA 1..192 1..192 774 74.5 Plus
Dwil\GK19844-PA 249 GK19844-PA 1..194 1..192 582 57.9 Plus
Dwil\GK16521-PA 250 GK16521-PA 1..192 1..192 537 51.6 Plus
Dwil\GK16827-PA 249 GK16827-PA 1..191 1..192 484 50.8 Plus
Dwil\GK15026-PA 253 GK15026-PA 1..194 1..193 476 47.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:09:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15260-PA 247 GE15260-PA 1..192 1..192 986 97.4 Plus
Dyak\GE15259-PA 247 GE15259-PA 1..192 1..192 611 60.1 Plus
Dyak\GE17313-PA 250 GE17313-PA 1..192 1..192 551 53.6 Plus
Dyak\GE20052-PA 266 GE20052-PA 15..206 1..192 479 47.7 Plus
Dyak\GE18948-PA 251 GE18948-PA 1..192 1..192 470 47.7 Plus

GH12380.hyp Sequence

Translation from 111 to 713

> GH12380.hyp
MERWHDRVAVVTGASSGIGAAVARHLVSAGVIVVGLARRVDRMKAIKEQL
PPELQGRLHAIHCDVEDLDSVTAAFDWIEEQLGGCDILVNNAGCLNPGQL
LTLELEQLQQVLNVNLMGVVICTRRAFRSMQQREVDGHVILINSLTGRNI
INPPGDELQVLNMYPLTKHGVTAMLEVLRQELRGFKTKIKVTVSAQKSIK
*

GH12380.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:30:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG40486-PC 247 CG40486-PC 1..192 1..192 979 100 Plus
CG40486-PB 247 CG40486-PB 1..192 1..192 979 100 Plus
CG40485-PA 231 CG40485-PA 1..194 1..194 604 59.3 Plus
CG40485-PB 247 CG40485-PB 1..192 1..192 596 58.9 Plus
antdh-PA 250 CG1386-PA 1..192 1..192 543 54.7 Plus