Clone GH12382 Report

Search the DGRC for GH12382

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:123
Well:82
Vector:pOT2
Associated Gene/TranscriptCG3214-RA
Protein status:GH12382.pep: validated not full length
Preliminary Size:539
Sequenced Size:544

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3214 2002-01-01 Sim4 clustering to Release 2
CG3214 2002-05-18 Blastp of sequenced clone
CG3214 2008-04-29 Release 5.5 accounting
CG3214 2008-08-15 Release 5.9 accounting
CG3214 2008-12-18 5.12 accounting

Clone Sequence Records

GH12382.complete Sequence

544 bp (544 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118779

> GH12382.complete
CAAAGTTTTTGGGCATCAACCGGCTGACAAAGCTGTTCCAGATGGTCCGC
GAAGCCGGAGGACTGAAGCAAGCGTACCTGAAGCTCTATAGGAACGATGA
TCTGAAGATCGGAACCCTGGTGGGCATCGACAAGTACGGCAACAAGTACT
TCGAGAACCCGTACTACTTCTACGGCCGCAATCGCTGGATCGAGTTCGCC
CCCCACGTCAACATGGACTACGATGGATCCATGATTCCCGCCGAGTGGTA
CGGCTGGATGCACTACAAGACCGATCTGCCTCCCATTCGCGATGGATGCC
GCCCCAAGTACAAGTGGATAGCGGACCACAGCGAGAATCTTTCCGGAACT
AAGGAGGCCTACTACCCCTACTCCACAACACCCAACAAAGTGGAGGCCTG
GGAACCCAAGGCGAAGAAGCAGTAGTGTGGCATAGCTTATAATTATTTTT
AAATTCAAGTGCAAATGGCTGCGATTGATGAGAACACCCGATCGAGTTAA
TAAACCCAATTTTGTTGACTCTGCAAAAAAAAAAAAAAAAAAAA

GH12382.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:27:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG3214-RB 764 CG3214-RB 139..663 1..525 2625 100 Plus
CG3214-RA 766 CG3214-RA 141..665 1..525 2625 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:47:52
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 2579424..2579603 269..90 900 100 Minus
chr2L 23010047 chr2L 2579065..2579232 521..354 825 99.4 Minus
chr2L 23010047 chr2L 2579664..2579755 92..1 430 97.8 Minus
chr2L 23010047 chr2L 2579288..2579374 354..268 420 98.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:46:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:47:51
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2579619..2579798 269..90 900 100 Minus
2L 23513712 2L 2579256..2579427 525..354 860 100 Minus
2L 23513712 2L 2579859..2579950 92..1 460 100 Minus
2L 23513712 2L 2579483..2579569 354..268 435 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:19:11
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2579619..2579798 269..90 900 100 Minus
2L 23513712 2L 2579256..2579427 525..354 860 100 Minus
2L 23513712 2L 2579859..2579950 92..1 460 100 Minus
2L 23513712 2L 2579483..2579569 354..268 435 100 Minus
Blast to na_te.dros performed on 2019-03-16 02:47:51 has no hits.

GH12382.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:48:52 Download gff for GH12382.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 2579062..2579231 355..524 98 <- Minus
chr2L 2579288..2579372 270..354 98 <- Minus
chr2L 2579424..2579601 92..269 100 <- Minus
chr2L 2579665..2579755 1..91 97   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:37:44 Download gff for GH12382.complete
Subject Subject Range Query Range Percent Splice Strand
CG3214-RB 5..429 1..425 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:50:00 Download gff for GH12382.complete
Subject Subject Range Query Range Percent Splice Strand
CG3214-RB 5..429 1..425 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:01:34 Download gff for GH12382.complete
Subject Subject Range Query Range Percent Splice Strand
CG3214-RC 5..429 1..425 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:30:47 Download gff for GH12382.complete
Subject Subject Range Query Range Percent Splice Strand
CG3214-RB 5..429 1..425 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:21:24 Download gff for GH12382.complete
Subject Subject Range Query Range Percent Splice Strand
CG3214-RC 5..429 1..425 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:23:17 Download gff for GH12382.complete
Subject Subject Range Query Range Percent Splice Strand
CG3214-RA 89..612 1..524 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:50:00 Download gff for GH12382.complete
Subject Subject Range Query Range Percent Splice Strand
CG3214-RA 89..612 1..524 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:01:34 Download gff for GH12382.complete
Subject Subject Range Query Range Percent Splice Strand
CG3214-RC 154..677 1..524 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:30:48 Download gff for GH12382.complete
Subject Subject Range Query Range Percent Splice Strand
CG3214-RA 89..612 1..524 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:21:24 Download gff for GH12382.complete
Subject Subject Range Query Range Percent Splice Strand
CG3214-RC 154..677 1..524 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:48:52 Download gff for GH12382.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2579257..2579426 355..524 100 <- Minus
2L 2579483..2579567 270..354 100 <- Minus
2L 2579619..2579796 92..269 100 <- Minus
2L 2579860..2579950 1..91 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:48:52 Download gff for GH12382.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2579257..2579426 355..524 100 <- Minus
2L 2579483..2579567 270..354 100 <- Minus
2L 2579619..2579796 92..269 100 <- Minus
2L 2579860..2579950 1..91 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:48:52 Download gff for GH12382.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2579257..2579426 355..524 100 <- Minus
2L 2579483..2579567 270..354 100 <- Minus
2L 2579619..2579796 92..269 100 <- Minus
2L 2579860..2579950 1..91 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:01:34 Download gff for GH12382.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2579860..2579950 1..91 100   Minus
arm_2L 2579257..2579426 355..524 100 <- Minus
arm_2L 2579483..2579567 270..354 100 <- Minus
arm_2L 2579619..2579796 92..269 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:09:10 Download gff for GH12382.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2579257..2579426 355..524 100 <- Minus
2L 2579483..2579567 270..354 100 <- Minus
2L 2579619..2579796 92..269 100 <- Minus
2L 2579860..2579950 1..91 100   Minus

GH12382.pep Sequence

Translation from 2 to 424

> GH12382.pep
KFLGINRLTKLFQMVREAGGLKQAYLKLYRNDDLKIGTLVGIDKYGNKYF
ENPYYFYGRNRWIEFAPHVNMDYDGSMIPAEWYGWMHYKTDLPPIRDGCR
PKYKWIADHSENLSGTKEAYYPYSTTPNKVEAWEPKAKKQ*

GH12382.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:55:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20596-PA 142 GF20596-PA 3..142 1..140 709 91.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:55:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24505-PA 141 GG24505-PA 3..141 1..139 732 97.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:55:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10577-PA 141 GH10577-PA 4..141 2..139 667 86.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:15:47
Subject Length Description Subject Range Query Range Score Percent Strand
ND-B17.2-PB 142 CG3214-PB 3..142 1..140 788 100 Plus
ND-B17.2-PA 142 CG3214-PA 3..142 1..140 788 100 Plus
ND-B17.2-PC 142 CG3214-PC 3..142 1..140 788 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:55:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23033-PA 140 GI23033-PA 3..140 1..138 662 87 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:55:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26457-PA 142 GL26457-PA 3..142 1..140 700 91.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:55:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16708-PA 142 GA16708-PA 3..142 1..140 700 91.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:55:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18212-PA 142 GM18212-PA 3..142 1..140 738 97.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:55:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22820-PA 142 GD22820-PA 3..142 1..140 738 97.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:55:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23557-PA 141 GJ23557-PA 4..141 2..139 639 82.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:55:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24493-PA 141 GK24493-PA 3..141 1..139 689 91.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:56:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15071-PA 142 GE15071-PA 3..142 1..140 736 97.1 Plus

GH12382.hyp Sequence

Translation from 2 to 424

> GH12382.hyp
KFLGINRLTKLFQMVREAGGLKQAYLKLYRNDDLKIGTLVGIDKYGNKYF
ENPYYFYGRNRWIEFAPHVNMDYDGSMIPAEWYGWMHYKTDLPPIRDGCR
PKYKWIADHSENLSGTKEAYYPYSTTPNKVEAWEPKAKKQ*

GH12382.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:31:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG3214-PB 142 CG3214-PB 3..142 1..140 788 100 Plus
CG3214-PA 142 CG3214-PA 3..142 1..140 788 100 Plus
CG3214-PC 142 CG3214-PC 3..142 1..140 788 100 Plus