Clone GH12395 Report

Search the DGRC for GH12395

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:123
Well:95
Vector:pOT2
Associated Gene/TranscriptCG31200-RA
Protein status:GH12395.pep: gold
Preliminary Size:1043
Sequenced Size:939

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17837 2001-01-01 Release 2 assignment
CG31200 2001-10-10 Blastp of sequenced clone
CG31199 2003-01-01 Sim4 clustering to Release 3
CG31200 2008-04-29 Release 5.5 accounting
CG31200 2008-08-15 Release 5.9 accounting
CG31200 2008-12-18 5.12 accounting

Clone Sequence Records

GH12395.complete Sequence

939 bp (939 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060683

> GH12395.complete
CACATCGTCATAAAAATGCTTCACAGCGGAAAACTTGTTCAGCTTTTGAC
TCTGGCTTGGCTAGGCGCATTGACGATGGCAGAATTTCGATGCGGTCGTC
TGGATGAAAAGCTATTGTACACCACCAACGAGCAGGCGGAACCCTCCGAG
AATCCCTGGGTGGGCATTCTGCTGGAGGATCAGGGAAATCGGTACGAGAA
TACAAGGTGCTCCGTAGTTATTATTAACGAGCTGCACATCCTCAGTACTG
CGACGTGCGTAAAGCGCTTTAGCCAACGATCCGGAGACACCAAAGCCGTG
GCAATGTTGGGCGTTTGGGACGAGACTGACTCCCCGGAGGAGGAGCTGTC
GTGCAACGACAAGGACTTCTGTGTGCCGGGGCCTGAGCTGTACAAGGTGG
TGGAGATCAAGGTCCATCCGCAAACGGACAAGGACACGGGGGACAACGAC
TTGGCCATCCTTCGGCTGGAAAAACCAGTCGAGTGGACCAACTGGGTTCA
GCCGATCTGCTTGGAGGGCACTTCGGAACCGGAAACGCTGACCAATCGCA
ACCTGCACTACACCGGATTCAACCATATGGCCTCGGAGAAGGGCAAGGGG
TTGGCCATGACAGTATCTACTCAAAAGTGCAAACAATTGACATCCTCCAG
CGTCCTAGTACCGGTGAACCAGCTGTGCGGCTATCCCGTGAAGAGGACCA
AGTTCTATCCGGGAGCACCACTGATGGACATCGATGTGCGAGATGAGAAG
CCGCACAACTTCTACCTGGTGGGCATTCTGGTCCGGAACGTAGATGCCGG
ACAGGCTACCACTCAAGTCTATCAGAATGTCCGACGCGCCCGCTCCTGGA
TAATGGAAAATTTGAAGTAGAAAGTACAACTTGTTATGTGAATACTCAAT
AAACTATTCAACATGAAAAAAAAAAAAAAAAAAAAAAAA

GH12395.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:12:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG31200.a 1149 CG31200.a 16..931 1..916 4580 100 Plus
CG31200-RA 1195 CG31200-RA 62..977 1..916 4580 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:58:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 16568149..16568880 915..184 3660 100 Minus
chr3R 27901430 chr3R 16569001..16569119 185..67 595 100 Minus
chr3R 27901430 chr3R 16569187..16569253 67..1 335 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:46:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:58:48
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20744233..20744965 916..184 3665 100 Minus
3R 32079331 3R 20745086..20745204 185..67 595 100 Minus
3R 32079331 3R 20745272..20745338 67..1 335 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:36:09
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 20485064..20485796 916..184 3665 100 Minus
3R 31820162 3R 20485917..20486035 185..67 595 100 Minus
3R 31820162 3R 20486103..20486169 67..1 335 100 Minus
Blast to na_te.dros performed on 2019-03-16 02:58:49 has no hits.

GH12395.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:59:42 Download gff for GH12395.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 16568149..16568879 185..915 100 <- Minus
chr3R 16569002..16569118 68..184 100 <- Minus
chr3R 16569187..16569253 1..67 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:37:47 Download gff for GH12395.complete
Subject Subject Range Query Range Percent Splice Strand
CG31200-RA 1..855 16..870 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:52:03 Download gff for GH12395.complete
Subject Subject Range Query Range Percent Splice Strand
CG31200-RA 1..855 16..870 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:02:08 Download gff for GH12395.complete
Subject Subject Range Query Range Percent Splice Strand
CG31200-RA 1..855 16..870 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:21:17 Download gff for GH12395.complete
Subject Subject Range Query Range Percent Splice Strand
CG31200-RA 1..855 16..870 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:27:32 Download gff for GH12395.complete
Subject Subject Range Query Range Percent Splice Strand
CG31200-RA 1..855 16..870 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:37:01 Download gff for GH12395.complete
Subject Subject Range Query Range Percent Splice Strand
CG31200-RA 1..915 1..915 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:52:02 Download gff for GH12395.complete
Subject Subject Range Query Range Percent Splice Strand
CG31200-RA 1..915 1..915 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:02:08 Download gff for GH12395.complete
Subject Subject Range Query Range Percent Splice Strand
CG31200-RA 1..915 1..915 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:21:17 Download gff for GH12395.complete
Subject Subject Range Query Range Percent Splice Strand
CG31200-RA 1..915 1..915 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:27:32 Download gff for GH12395.complete
Subject Subject Range Query Range Percent Splice Strand
CG31200-RA 1..915 1..915 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:59:42 Download gff for GH12395.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20744234..20744964 185..915 100 <- Minus
3R 20745087..20745203 68..184 100 <- Minus
3R 20745272..20745338 1..67 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:59:42 Download gff for GH12395.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20744234..20744964 185..915 100 <- Minus
3R 20745087..20745203 68..184 100 <- Minus
3R 20745272..20745338 1..67 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:59:42 Download gff for GH12395.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20744234..20744964 185..915 100 <- Minus
3R 20745087..20745203 68..184 100 <- Minus
3R 20745272..20745338 1..67 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:02:08 Download gff for GH12395.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16569956..16570686 185..915 100 <- Minus
arm_3R 16570809..16570925 68..184 100 <- Minus
arm_3R 16570994..16571060 1..67 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:57:55 Download gff for GH12395.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20485065..20485795 185..915 100 <- Minus
3R 20485918..20486034 68..184 100 <- Minus
3R 20486103..20486169 1..67 100   Minus

GH12395.hyp Sequence

Translation from 1 to 869

> GH12395.hyp
HIVIKMLHSGKLVQLLTLAWLGALTMAEFRCGRLDEKLLYTTNEQAEPSE
NPWVGILLEDQGNRYENTRCSVVIINELHILSTATCVKRFSQRSGDTKAV
AMLGVWDETDSPEEELSCNDKDFCVPGPELYKVVEIKVHPQTDKDTGDND
LAILRLEKPVEWTNWVQPICLEGTSEPETLTNRNLHYTGFNHMASEKGKG
LAMTVSTQKCKQLTSSSVLVPVNQLCGYPVKRTKFYPGAPLMDIDVRDEK
PHNFYLVGILVRNVDAGQATTQVYQNVRRARSWIMENLK*

GH12395.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:31:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG31200-PA 284 CG31200-PA 1..284 6..289 1510 100 Plus
CG31199-PA 293 CG31199-PA 28..259 30..261 223 28.7 Plus
CG31205-PC 274 CG31205-PC 29..269 31..287 188 26 Plus
CG31205-PB 274 CG31205-PB 29..269 31..287 188 26 Plus
CG3505-PA 360 CG3505-PA 86..359 19..289 186 27.1 Plus

GH12395.pep Sequence

Translation from 15 to 869

> GH12395.pep
MLHSGKLVQLLTLAWLGALTMAEFRCGRLDEKLLYTTNEQAEPSENPWVG
ILLEDQGNRYENTRCSVVIINELHILSTATCVKRFSQRSGDTKAVAMLGV
WDETDSPEEELSCNDKDFCVPGPELYKVVEIKVHPQTDKDTGDNDLAILR
LEKPVEWTNWVQPICLEGTSEPETLTNRNLHYTGFNHMASEKGKGLAMTV
STQKCKQLTSSSVLVPVNQLCGYPVKRTKFYPGAPLMDIDVRDEKPHNFY
LVGILVRNVDAGQATTQVYQNVRRARSWIMENLK*

GH12395.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:32:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18317-PA 284 GF18317-PA 2..280 4..282 1066 71.3 Plus
Dana\GF18318-PA 292 GF18318-PA 26..258 23..256 266 29.4 Plus
Dana\GF16189-PA 413 GF16189-PA 121..385 26..279 168 28.8 Plus
Dana\GF16689-PA 823 GF16689-PA 17..236 26..259 163 26.6 Plus
Dana\GF16689-PA 823 GF16689-PA 580..822 29..283 158 21.9 Plus
Dana\GF16689-PA 823 GF16689-PA 258..476 26..259 153 25.1 Plus
Dana\GF18202-PA 393 GF18202-PA 141..361 45..255 146 25.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:32:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15191-PA 284 GG15191-PA 1..284 1..284 1350 87.3 Plus
Dere\GG15203-PA 292 GG15203-PA 26..258 23..256 242 28.6 Plus
Dere\GG24066-PA 309 GG24066-PA 68..306 26..282 203 26.3 Plus
Dere\GG16868-PA 360 GG16868-PA 88..328 16..256 180 26.4 Plus
Dere\GG11949-PA 421 GG11949-PA 138..284 26..176 167 34.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:32:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16014-PA 285 GH16014-PA 4..281 4..284 622 41.5 Plus
Dgri\GH14240-PA 284 GH14240-PA 24..282 22..284 578 41.4 Plus
Dgri\GH12943-PA 260 GH12943-PA 1..254 33..284 274 29.1 Plus
Dgri\GH14213-PA 294 GH14213-PA 13..284 13..283 232 27.2 Plus
Dgri\GH17229-PA 387 GH17229-PA 117..355 26..255 164 27.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:02:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG31200-PA 284 CG31200-PA 1..284 1..284 1510 100 Plus
CG31199-PA 293 CG31199-PA 28..259 25..256 223 28.7 Plus
CG31205-PC 274 CG31205-PC 29..269 26..282 188 26 Plus
CG31205-PB 274 CG31205-PB 29..269 26..282 188 26 Plus
CG3505-PA 360 CG3505-PA 86..359 14..284 186 27.1 Plus
CG9737-PA 424 CG9737-PA 142..287 26..175 159 33.8 Plus
MP1-PA 390 CG1102-PA 138..389 45..284 157 25 Plus
MP1-PC 399 CG1102-PC 147..398 45..284 157 25 Plus
MP1-PE 400 CG1102-PE 148..399 45..284 157 25 Plus
CG10232-PD 509 CG10232-PD 248..508 26..284 153 25.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:32:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22159-PA 288 GI22159-PA 1..284 1..284 650 42.6 Plus
Dmoj\GI22160-PA 293 GI22160-PA 3..285 2..282 308 30.2 Plus
Dmoj\GI10684-PA 372 GI10684-PA 84..371 2..284 201 26.9 Plus
Dmoj\GI24877-PA 392 GI24877-PA 119..360 25..255 159 23.3 Plus
Dmoj\GI24320-PA 447 GI24320-PA 179..446 26..284 152 28.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:32:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27131-PA 286 GL27131-PA 18..282 18..282 999 64.5 Plus
Dper\GL27132-PA 291 GL27132-PA 1..257 2..256 297 30.9 Plus
Dper\GL18574-PA 293 GL18574-PA 27..292 26..283 276 27 Plus
Dper\GL14057-PA 418 GL14057-PA 141..410 26..284 158 29.3 Plus
Dper\GL13651-PA 382 GL13651-PA 156..278 65..187 155 32.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:32:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16087-PA 286 GA16087-PA 1..282 1..282 1044 63.1 Plus
Dpse\GA16086-PA 291 GA16086-PA 1..257 2..256 297 30.2 Plus
Dpse\GA25698-PA 293 GA25698-PA 27..292 26..283 273 26.7 Plus
Dpse\GA30057-PA 295 GA30057-PA 49..293 26..284 262 28.3 Plus
Dpse\GA30055-PA 263 GA30055-PA 14..262 25..284 255 29.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:32:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23165-PA 284 GM23165-PA 1..284 1..284 1466 95.4 Plus
Dsec\GM23166-PA 293 GM23166-PA 28..259 25..256 228 28.7 Plus
Dsec\GM23130-PA 298 GM23130-PA 61..295 26..282 206 25.8 Plus
Dsec\GM24177-PA 360 GM24177-PA 86..359 14..284 186 27.2 Plus
Dsec\GM12164-PA 425 GM12164-PA 142..288 26..176 166 34.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:32:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20038-PA 284 GD20038-PA 1..284 1..284 1454 94.4 Plus
Dsim\GD20039-PA 293 GD20039-PA 28..259 25..256 237 29.5 Plus
Dsim\GD19370-PA 276 GD19370-PA 7..258 10..279 231 29.6 Plus
Dsim\GD19368-PA 298 GD19368-PA 61..295 26..282 206 26.1 Plus
Dsim\GD18970-PA 360 GD18970-PA 84..359 12..284 188 27 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:32:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24278-PA 290 GJ24278-PA 14..290 5..284 641 43.9 Plus
Dvir\GJ24280-PA 290 GJ24280-PA 14..290 5..284 640 43.9 Plus
Dvir\GJ24279-PA 287 GJ24279-PA 3..284 2..282 294 28.3 Plus
Dvir\GJ24282-PA 287 GJ24282-PA 3..284 2..282 284 27.3 Plus
Dvir\GJ24354-PA 326 GJ24354-PA 80..325 44..284 196 28.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:32:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22701-PA 285 GK22701-PA 27..283 26..284 710 48.3 Plus
Dwil\GK22703-PA 286 GK22703-PA 11..251 13..255 318 32.5 Plus
Dwil\GK21103-PA 272 GK21103-PA 24..270 26..282 202 26.4 Plus
Dwil\GK25361-PA 404 GK25361-PA 141..399 44..284 166 26.2 Plus
Dwil\GK25360-PA 410 GK25360-PA 147..273 44..166 160 34.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:32:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25044-PA 284 GE25044-PA 1..284 1..284 1403 90.1 Plus
Dyak\GE25681-PA 369 GE25681-PA 114..351 25..279 239 27.7 Plus
Dyak\GE25045-PA 292 GE25045-PA 28..258 25..256 224 28 Plus
Dyak\GE25680-PA 292 GE25680-PA 61..289 26..282 180 24.5 Plus
Dyak\GE24249-PA 360 GE24249-PA 86..328 14..256 176 26.6 Plus