Clone GH12454 Report

Search the DGRC for GH12454

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:124
Well:54
Vector:pOT2
Associated Gene/Transcriptl(2)37Cc-RA
Protein status:GH12454.pep: gold
Preliminary Size:1367
Sequenced Size:1328

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10691 2001-01-01 Release 2 assignment
CG10691 2002-06-12 Blastp of sequenced clone
CG10691 2003-01-01 Sim4 clustering to Release 3
l(2)37Cc 2008-04-29 Release 5.5 accounting
l(2)37Cc 2008-08-15 Release 5.9 accounting
l(2)37Cc 2008-12-18 5.12 accounting

Clone Sequence Records

GH12454.complete Sequence

1328 bp (1328 high quality bases) assembled on 2002-06-12

GenBank Submission: AY122111

> GH12454.complete
CGATAACAGGCCGTGTGGTTGTATTTCGTGTTTTGCATTTCAAAGAGCAA
AATTGCACAATAATTTAATTTAAGTGCAACCAAAAACCTTTAACAAGATA
ATGGCTGCTCAGTTCTTTAATCGCATTGGCCAAATGGGCCTCGGAGTGGC
CGTTTTGGGTGGCGTTGTCAATTCGGCATTATATAATGTGGAAGGCGGCC
ACCGGGCGGTCATCTTCGATCGCTTCACCGGCATCAAGGAGAACGTGGTC
GGCGAGGGTACCCACTTCTTCATCCCATGGGTGCAGCGGCCCATCATCTT
CGACATCCGGTCCCAGCCCCGCAACGTTCCTGTGATAACGGGCAGCAAGG
ATCTGCAGAATGTCAACATCACGCTCCGAATCCTGTACCGCCCCATTCCA
GACCAGCTGCCCAAGATCTACACCATTCTCGGCCAGGACTACGACGAGCG
TGTCCTGCCCTCCATCGCGCCTGAGGTGCTGAAGGCTGTGGTCGCCCAGT
TCGACGCCGGCGAGCTGATCACCCAGCGTGAGATGGTGTCGCAGCGCGTT
TCCCAGGAACTGACTGTACGTGCCAAGCAGTTCGGCTTTATTCTGGATGA
CATCTCGCTCACGCACTTGACCTTCGGTCGGGAGTTCACGCTGGCCGTCG
AGATGAAGCAGGTGGCCCAGCAGGAGGCGGAGAAGGCGCGTTTTGTCGTG
GAGAAGGCCGAGCAACAGAAGCTGGCGTCCATCATTTCGGCGGAGGGTGA
TGCCGAAGCCGCTGGCCTGTTGGCCAAGTCATTCGGCGAGGCCGGAGACG
GTCTGGTGGAGCTGCGACGTATTGAGGCCGCCGAGGATATCGCCTACCAG
CTATCCCGGTCCCGTGGTGTCGCCTACTTGCCCAGCGGACAGAGCACGCT
GCTCAATCTGCCATCGACCATCGCGCAGTAGCTGGGTGCATCTAGTTCCG
TTAAGTTGTAACTACCTATAGCATTTACTAAGTACTTTTCGATTTTGTTT
CTGCTGAAATATGCACTACTCTAAAGCGTTCGCGCCCGACTGACTGGAGA
ATACTAAGCGAAACAACCAAAATTTGTCTCATGTAATCGGTTTTTCCATT
ATCTTCCCGATCGGGTTCGAAATCCGGTCGCAGTGTGCGCTCCGAATGCG
GCTCAACTTTTGTTGTTTCCGTTTGAGTCGTTCGTGTGCGCGTCCTGCTG
AATTGGTCCTTAAGATCGGCACCGGGCTTAAAACAACTCCAGTAATTGAA
AGAAACACAGACCGTAAGAAAATTTCATTATGTGAACAAACAATAAATGA
TAATCCCTACAAAAAAAAAAAAAAAAAA

GH12454.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:48:23
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)37Cc-RB 1426 l(2)37Cc-RB 15..1325 1..1311 6555 100 Plus
l(2)37Cc-RA 1532 l(2)37Cc-RA 302..1516 97..1311 6075 100 Plus
l(2)37Cc-RC 1267 l(2)37Cc-RC 486..1267 529..1310 3910 100 Plus
l(2)37Cc-RC 1267 l(2)37Cc-RC 15..489 1..475 2375 100 Plus
l(2)37Cc-RA 1532 l(2)37Cc-RA 6..102 1..97 485 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:01:21
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 19120631..19121410 1310..531 3885 99.9 Minus
chr2L 23010047 chr2L 19121712..19122147 532..97 2180 100 Minus
chr2L 23010047 chr2L 19122347..19122443 97..1 485 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:46:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:01:19
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19122039..19122819 1311..531 3905 100 Minus
2L 23513712 2L 19123121..19123556 532..97 2180 100 Minus
2L 23513712 2L 19123756..19123852 97..1 485 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:21:14
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19122039..19122819 1311..531 3905 100 Minus
2L 23513712 2L 19123121..19123556 532..97 2180 100 Minus
2L 23513712 2L 19123756..19123852 97..1 485 100 Minus
Blast to na_te.dros performed 2019-03-16 07:01:19
Subject Length Description Subject Range Query Range Score Percent Strand
TART-C 11124 TART-C TARTC 11124bp 169..203 48..14 112 80 Minus
TART-C 11124 TART-C TARTC 11124bp 10551..10585 48..14 112 80 Minus

GH12454.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:02:10 Download gff for GH12454.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 19120631..19121408 533..1310 99 <- Minus
chr2L 19121712..19122147 97..532 100 <- Minus
chr2L 19122348..19122443 1..96 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:37:59 Download gff for GH12454.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)37Cc-RA 1..831 101..931 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:23:35 Download gff for GH12454.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)37Cc-RA 1..831 101..931 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:42:57 Download gff for GH12454.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)37Cc-RB 1..831 101..931 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:14:16 Download gff for GH12454.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)37Cc-RA 1..831 101..931 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:24:54 Download gff for GH12454.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)37Cc-RB 1..831 101..931 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:50:44 Download gff for GH12454.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)37Cc-RB 12..1321 1..1310 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:23:35 Download gff for GH12454.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)37Cc-RB 15..1324 1..1310 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:42:57 Download gff for GH12454.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)37Cc-RB 18..1327 1..1310 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:14:16 Download gff for GH12454.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)37Cc-RB 12..1321 1..1310 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:24:54 Download gff for GH12454.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)37Cc-RB 18..1327 1..1310 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:02:10 Download gff for GH12454.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19122040..19122817 533..1310 100 <- Minus
2L 19123121..19123556 97..532 100 <- Minus
2L 19123757..19123852 1..96 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:02:10 Download gff for GH12454.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19122040..19122817 533..1310 100 <- Minus
2L 19123121..19123556 97..532 100 <- Minus
2L 19123757..19123852 1..96 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:02:10 Download gff for GH12454.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19122040..19122817 533..1310 100 <- Minus
2L 19123121..19123556 97..532 100 <- Minus
2L 19123757..19123852 1..96 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:42:57 Download gff for GH12454.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19122040..19122817 533..1310 100 <- Minus
arm_2L 19123121..19123556 97..532 100 <- Minus
arm_2L 19123757..19123852 1..96 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:47:12 Download gff for GH12454.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19122040..19122817 533..1310 100 <- Minus
2L 19123121..19123556 97..532 100 <- Minus
2L 19123757..19123852 1..96 100   Minus

GH12454.pep Sequence

Translation from 100 to 930

> GH12454.pep
MAAQFFNRIGQMGLGVAVLGGVVNSALYNVEGGHRAVIFDRFTGIKENVV
GEGTHFFIPWVQRPIIFDIRSQPRNVPVITGSKDLQNVNITLRILYRPIP
DQLPKIYTILGQDYDERVLPSIAPEVLKAVVAQFDAGELITQREMVSQRV
SQELTVRAKQFGFILDDISLTHLTFGREFTLAVEMKQVAQQEAEKARFVV
EKAEQQKLASIISAEGDAEAAGLLAKSFGEAGDGLVELRRIEAAEDIAYQ
LSRSRGVAYLPSGQSTLLNLPSTIAQ*

GH12454.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:30:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15209-PA 276 GF15209-PA 1..276 1..276 1406 98.2 Plus
Dana\GF11118-PA 241 GF11118-PA 39..240 24..225 615 56.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:30:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21649-PA 276 GG21649-PA 1..276 1..276 1433 100 Plus
Dere\GG21927-PA 326 GG21927-PA 41..271 26..270 610 50.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:30:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13482-PA 276 GH13482-PA 1..276 1..276 1424 98.9 Plus
Dgri\GH22126-PA 323 GH22126-PA 41..274 26..270 625 50.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:47:51
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)37Cc-PD 276 CG10691-PD 1..276 1..276 1370 100 Plus
l(2)37Cc-PA 276 CG10691-PA 1..276 1..276 1370 100 Plus
l(2)37Cc-PB 276 CG10691-PB 1..276 1..276 1370 100 Plus
Phb2-PF 299 CG15081-PF 21..283 12..270 644 50.6 Plus
Phb2-PA 299 CG15081-PA 21..283 12..270 644 50.6 Plus
Phb2-PB 299 CG15081-PB 21..283 12..270 644 50.6 Plus
Phb2-PC 299 CG15081-PC 21..283 12..270 644 50.6 Plus
Phb2-PD 303 CG15081-PD 21..283 12..270 644 50.6 Plus
Phb2-PE 338 CG15081-PE 21..283 12..270 644 50.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:30:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17234-PA 276 GI17234-PA 1..276 1..276 1392 96.7 Plus
Dmoj\GI19355-PA 315 GI19355-PA 41..264 26..270 602 49.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:30:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21128-PA 276 GL21128-PA 1..276 1..276 1409 98.2 Plus
Dper\GL11231-PA 229 GL11231-PA 38..227 23..212 574 55.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:30:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10498-PA 276 GA10498-PA 1..276 1..276 1409 98.2 Plus
Dpse\GA13475-PA 331 GA13475-PA 38..274 23..270 620 49.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:30:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17028-PA 276 GM17028-PA 1..276 1..276 1433 100 Plus
Dsec\GM21919-PA 361 GM21919-PA 41..306 26..270 641 48.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:30:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21777-PA 276 GD21777-PA 1..276 1..276 1433 100 Plus
Dsim\GD15441-PA 361 GD15441-PA 41..306 26..270 637 47.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:30:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17994-PA 276 GJ17994-PA 1..276 1..276 1403 97.5 Plus
Dvir\GJ20339-PA 323 GJ20339-PA 41..274 26..270 626 50.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:30:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24235-PA 276 GK24235-PA 1..276 1..276 1398 97.1 Plus
Dwil\GK18842-PA 299 GK18842-PA 41..283 26..270 655 52.2 Plus
Dwil\GK20926-PA 326 GK20926-PA 41..274 26..270 622 50.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:30:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12669-PA 276 GE12669-PA 1..276 1..276 1433 100 Plus
Dyak\GE12002-PA 338 GE12002-PA 39..283 24..270 660 51.8 Plus

GH12454.hyp Sequence

Translation from 100 to 930

> GH12454.hyp
MAAQFFNRIGQMGLGVAVLGGVVNSALYNVEGGHRAVIFDRFTGIKENVV
GEGTHFFIPWVQRPIIFDIRSQPRNVPVITGSKDLQNVNITLRILYRPIP
DQLPKIYTILGQDYDERVLPSIAPEVLKAVVAQFDAGELITQREMVSQRV
SQELTVRAKQFGFILDDISLTHLTFGREFTLAVEMKQVAQQEAEKARFVV
EKAEQQKLASIISAEGDAEAAGLLAKSFGEAGDGLVELRRIEAAEDIAYQ
LSRSRGVAYLPSGQSTLLNLPSTIAQ*

GH12454.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:31:58
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)37Cc-PD 276 CG10691-PD 1..276 1..276 1370 100 Plus
l(2)37Cc-PA 276 CG10691-PA 1..276 1..276 1370 100 Plus
l(2)37Cc-PB 276 CG10691-PB 1..276 1..276 1370 100 Plus
Phb2-PF 299 CG15081-PF 21..283 12..270 644 50.6 Plus
Phb2-PA 299 CG15081-PA 21..283 12..270 644 50.6 Plus