Clone GH12636 Report

Search the DGRC for GH12636

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:126
Well:36
Vector:pOT2
Associated Gene/TranscriptDat-RA
Protein status:GH12636.pep: gold
Preliminary Size:1300
Sequenced Size:1271

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3318 2002-05-17 Blastp of sequenced clone
CG3318 2003-01-01 Sim4 clustering to Release 3
Dat 2008-04-29 Release 5.5 accounting
Dat 2008-08-15 Release 5.9 accounting
Dat 2008-12-18 5.12 accounting

Clone Sequence Records

GH12636.complete Sequence

1271 bp (1271 high quality bases) assembled on 2002-05-17

GenBank Submission: AY118780

> GH12636.complete
CCATTAAAAAATAACACGAAAACGTTGGTCCCAAATCGCGAGAAGAATTC
CACCTCCCTAGCATTCGAGTACATATAAGATTCTCAAGCCTGCAAAAGCT
GGGCATCATCATTTCAAAAACGTGCTAACGGTTCACTTGGTCGGTCGAAT
CGGAACGAATCGGGCGAAAGTCTCCAACACAAATTCCGAAATTTAACGCT
TCGTGGTATCCAAATCGAAGGAGGCGGCGCATTAGGCCCACTTATTAGCC
AATTTCACGCCTGAACGACTTGTATCCGATCGCCCGGCTGACACAGAAAA
TGGAGGACGCATTGACCGTCTCTGGGAAGCCAGCCGCATGCCCCGTCGAC
CAGGACTGCCCCTACACCATCGAACTGATCCAGCCGGAGGATGGGGAGGC
GGTGATAGCCATGCTCAAGACCTTTTTCTTCAAGGATGAACCGCTGAACA
CCTTCCTCGACCTTGGCGAGTGCAAGGAGCTGGAGAAGTACTCCCTGAAA
CCGCTACCCGACAACTGCTCCTACAAGGCGGTCAACAAGAAGGGCGAGAT
TATCGGTGTGTTCCTAAATGGACTTATGAGGCGTCCGTCCCCCGATGATG
TGCCCGAAAAGGCGGCCGACTCCTGTGAACATCCCAAATTCAAGAAGATC
CTCTCGCTGATGGACCACGTGGAGGAGCAGTTCAACATCTTCGACGTGTA
TCCCGACGAGGAGCTCATCCTGGACGGCAAGATCCTGTCGGTGGACACCA
ACTACCGGGGCCTGGGCATCGCAGGCCGCCTGACGGAGAGGGCGTACGAG
TACATGCGGGAGAACGGCATCAATGTGTACCACGTGCTCTGCTCCAGCCA
CTACTCCGCCCGGGTGATGGAGAAGCTGGGCTTCCACGAGGTGTTCCGCA
TGCAGTTCGCCGACTACAAGCCTCAGGGAGAGGTGGTCTTCAAGCCGGCG
GCCCCGCACGTGGGCATACAGGTGATGGCCAAGGAAGTGGGTCCCGCGAA
GGCGGCGCAGACCAAGCTGTAGACGATCTGAGTTCGGATTTTGTACTATC
GTATGTGATTCTTTAGTTTGTAGTTCGGTGGCGGGTTCCCAGTAGTGTAT
CAACGTTCGATTCAGCGTAGTGTAAACAAACAGTACAAGTTACGTATTTA
TCTAATTTAATCTTCCCGTCGCGACGGTAAACTTAAGTGTTTTGTGTTTA
GAACGAGCTCAAAATAAAACCTTGTCTTAATAACATAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAA

GH12636.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:06:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dat-RA 1604 Dat-RA 333..1570 1..1238 6190 100 Plus
Dat-RB 1471 Dat-RB 496..1471 261..1236 4880 100 Plus
CG42568-RA 1454 CG42568-RA 1356..1454 1238..1140 495 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:40:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 20043119..20043768 587..1236 3250 100 Plus
chr2R 21145070 chr2R 20025589..20025848 1..260 1285 99.6 Plus
chr2R 21145070 chr2R 20041810..20041984 261..435 875 100 Plus
chr2R 21145070 chr2R 20042901..20043055 433..587 775 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:47:16 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:40:05
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24157113..24157764 587..1238 3260 100 Plus
2R 25286936 2R 24139602..24139861 1..260 1300 100 Plus
2R 25286936 2R 24155804..24155978 261..435 875 100 Plus
2R 25286936 2R 24156895..24157049 433..587 775 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:37:55
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24158312..24158963 587..1238 3260 100 Plus
2R 25260384 2R 24140801..24141060 1..260 1300 100 Plus
2R 25260384 2R 24157003..24157177 261..435 875 100 Plus
2R 25260384 2R 24158094..24158248 433..587 775 100 Plus
Blast to na_te.dros performed on 2019-03-15 15:40:05 has no hits.

GH12636.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:41:14 Download gff for GH12636.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 20042903..20043055 435..587 100 -> Plus
chr2R 20025589..20025848 1..260 99 -> Plus
chr2R 20041810..20041983 261..434 100 -> Plus
chr2R 20043120..20043768 588..1236 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:39:42 Download gff for GH12636.complete
Subject Subject Range Query Range Percent Splice Strand
Dat-RB 67..828 261..1022 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:49:31 Download gff for GH12636.complete
Subject Subject Range Query Range Percent Splice Strand
Dat-RB 67..828 261..1022 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:35:54 Download gff for GH12636.complete
Subject Subject Range Query Range Percent Splice Strand
Dat-RB 67..828 261..1022 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:42:09 Download gff for GH12636.complete
Subject Subject Range Query Range Percent Splice Strand
Dat-RB 67..828 261..1022 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:12:22 Download gff for GH12636.complete
Subject Subject Range Query Range Percent Splice Strand
Dat-RB 67..828 261..1022 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:39:41 Download gff for GH12636.complete
Subject Subject Range Query Range Percent Splice Strand
Dat-RA 18..1253 1..1236 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:49:31 Download gff for GH12636.complete
Subject Subject Range Query Range Percent Splice Strand
Dat-RA 18..1253 1..1236 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:35:54 Download gff for GH12636.complete
Subject Subject Range Query Range Percent Splice Strand
Dat-RA 40..1275 1..1236 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:42:09 Download gff for GH12636.complete
Subject Subject Range Query Range Percent Splice Strand
Dat-RA 18..1253 1..1236 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:12:22 Download gff for GH12636.complete
Subject Subject Range Query Range Percent Splice Strand
Dat-RA 40..1275 1..1236 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:41:14 Download gff for GH12636.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24156897..24157049 435..587 100 -> Plus
2R 24139602..24139861 1..260 100 -> Plus
2R 24155804..24155977 261..434 100 -> Plus
2R 24157114..24157762 588..1236 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:41:14 Download gff for GH12636.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24156897..24157049 435..587 100 -> Plus
2R 24139602..24139861 1..260 100 -> Plus
2R 24155804..24155977 261..434 100 -> Plus
2R 24157114..24157762 588..1236 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:41:14 Download gff for GH12636.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24156897..24157049 435..587 100 -> Plus
2R 24139602..24139861 1..260 100 -> Plus
2R 24155804..24155977 261..434 100 -> Plus
2R 24157114..24157762 588..1236 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:35:54 Download gff for GH12636.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20043327..20043500 261..434 100 -> Plus
arm_2R 20044420..20044572 435..587 100 -> Plus
arm_2R 20027125..20027384 1..260 100 -> Plus
arm_2R 20044637..20045285 588..1236 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:14:25 Download gff for GH12636.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24140819..24141078 1..260 100 -> Plus
2R 24157021..24157194 261..434 100 -> Plus
2R 24158114..24158266 435..587 100 -> Plus
2R 24158331..24158979 588..1236 100   Plus

GH12636.pep Sequence

Translation from 299 to 1021

> GH12636.pep
MEDALTVSGKPAACPVDQDCPYTIELIQPEDGEAVIAMLKTFFFKDEPLN
TFLDLGECKELEKYSLKPLPDNCSYKAVNKKGEIIGVFLNGLMRRPSPDD
VPEKAADSCEHPKFKKILSLMDHVEEQFNIFDVYPDEELILDGKILSVDT
NYRGLGIAGRLTERAYEYMRENGINVYHVLCSSHYSARVMEKLGFHEVFR
MQFADYKPQGEVVFKPAAPHVGIQVMAKEVGPAKAAQTKL*

GH12636.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:50:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11376-PA 275 GF11376-PA 41..275 1..240 1057 82.2 Plus
Dana\GF22216-PA 229 GF22216-PA 4..218 25..230 257 32.6 Plus
Dana\GF24634-PA 222 GF24634-PA 10..218 23..226 203 29.9 Plus
Dana\GF21065-PA 215 GF21065-PA 9..210 27..225 185 28.4 Plus
Dana\GF20033-PA 209 GF20033-PA 13..205 39..226 171 27.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:50:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22946-PA 275 GG22946-PA 36..275 1..240 1258 97.9 Plus
Dere\GG12937-PA 231 GG12937-PA 4..219 25..230 239 30 Plus
Dere\GG21595-PA 222 GG21595-PA 10..218 23..226 215 31.2 Plus
Dere\GG21596-PA 222 GG21596-PA 10..219 23..227 210 29.9 Plus
Dere\GG10399-PA 216 GG10399-PA 5..213 23..227 185 31 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:50:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19975-PA 277 GH19975-PA 54..272 17..234 938 76.7 Plus
Dgri\GH11973-PA 226 GH11973-PA 4..218 25..230 232 34.2 Plus
Dgri\GH10999-PA 223 GH10999-PA 13..219 24..226 221 32.5 Plus
Dgri\GH12774-PA 217 GH12774-PA 18..214 30..227 165 27.9 Plus
Dgri\GH11001-PA 214 GH11001-PA 8..211 27..227 152 26.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:55:19
Subject Length Description Subject Range Query Range Score Percent Strand
AANAT1-PA 240 CG3318-PA 1..240 1..240 1266 100 Plus
AANAT1-PB 275 CG3318-PB 36..275 1..240 1266 100 Plus
AANATL7-PD 228 CG13759-PD 4..216 25..230 234 29.5 Plus
AANATL7-PC 228 CG13759-PC 4..216 25..230 234 29.5 Plus
AANATL7-PB 228 CG13759-PB 4..216 25..230 234 29.5 Plus
AANATL7-PA 228 CG13759-PA 4..216 25..230 234 29.5 Plus
AANATL3-PA 222 CG10659-PA 10..218 23..226 208 29.6 Plus
AANATL4-PA 224 CG18607-PA 10..221 23..227 186 28.7 Plus
AANATL2-PB 216 CG9486-PB 5..213 23..227 175 30.6 Plus
AANATL2-PA 216 CG9486-PA 5..213 23..227 175 30.6 Plus
AANATL5-PA 222 CG10476-PA 3..222 16..230 153 24.8 Plus
AgmNAT-PA 216 CG15766-PA 2..210 13..224 151 24.8 Plus
AANATL6-PB 222 CG18606-PB 3..222 16..230 148 24.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:50:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20262-PA 264 GI20262-PA 34..263 3..236 935 71.4 Plus
Dmoj\GI14714-PA 223 GI14714-PA 4..218 25..230 271 34.6 Plus
Dmoj\GI17517-PA 224 GI17517-PA 13..220 24..226 212 30.5 Plus
Dmoj\GI11371-PA 222 GI11371-PA 13..218 24..226 206 29.4 Plus
Dmoj\GI17524-PA 222 GI17524-PA 35..219 46..227 203 30.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:50:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17369-PA 290 GL17369-PA 38..290 1..240 1059 80.2 Plus
Dper\GL14179-PA 229 GL14179-PA 4..220 25..231 245 34.5 Plus
Dper\GL11101-PA 224 GL11101-PA 12..220 23..226 212 30.4 Plus
Dper\GL15167-PA 215 GL15167-PA 9..205 24..220 197 28.4 Plus
Dper\GL25512-PA 221 GL25512-PA 7..218 23..227 169 30.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:50:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17346-PA 290 GA17346-PA 38..290 1..240 1059 80.2 Plus
Dpse\GA12509-PA 229 GA12509-PA 4..220 25..231 245 34.5 Plus
Dpse\GA24612-PA 224 GA24612-PA 12..220 23..226 216 30.4 Plus
Dpse\GA28106-PA 219 GA28106-PA 10..215 23..226 202 31.5 Plus
Dpse\GA13941-PA 215 GA13941-PA 9..205 24..220 197 28.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:50:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\Dat-PA 235 GM18311-PA 36..235 1..240 856 72.2 Plus
Dsec\GM19229-PA 228 GM19229-PA 4..216 25..230 243 31.7 Plus
Dsec\GM21944-PA 224 GM21944-PA 10..221 23..227 215 30.7 Plus
Dsec\GM18616-PA 216 GM18616-PA 5..213 23..227 168 30.9 Plus
Dsec\GM12613-PA 216 GM12613-PA 4..211 21..225 162 25.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:50:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Dat-PA 241 GD15464-PA 36..237 1..202 1039 94.6 Plus
Dsim\GD16609-PA 272 GD16609-PA 48..260 25..230 243 31.7 Plus
Dsim\GD21720-PA 222 GD21720-PA 10..218 23..226 211 30.5 Plus
Dsim\GD11441-PA 224 GD11441-PA 10..221 23..227 203 28.9 Plus
Dsim\GD23397-PA 216 GD23397-PA 5..213 23..227 171 31.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:50:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20215-PA 275 GJ20215-PA 39..270 3..234 935 72.8 Plus
Dvir\GJ16779-PA 232 GJ16779-PA 4..218 25..230 260 33.6 Plus
Dvir\GJ18418-PA 224 GJ18418-PA 5..220 16..226 243 32.6 Plus
Dvir\GJ15312-PA 224 GJ15312-PA 5..220 16..226 240 32.6 Plus
Dvir\GJ15301-PA 221 GJ15301-PA 13..217 24..226 227 32.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:50:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23036-PA 273 GK23036-PA 36..272 1..234 993 78.5 Plus
Dwil\GK10244-PA 231 GK10244-PA 4..215 25..230 234 31.9 Plus
Dwil\GK15377-PA 223 GK15377-PA 10..220 23..227 210 31 Plus
Dwil\GK15374-PA 209 GK15374-PA 1..205 27..226 209 30.6 Plus
Dwil\GK15375-PA 223 GK15375-PA 10..220 23..227 206 30.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:50:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14383-PA 275 GE14383-PA 36..275 1..240 1224 95.4 Plus
Dyak\GE16262-PA 231 GE16262-PA 4..218 25..230 244 30.9 Plus
Dyak\GE12614-PA 222 GE12614-PA 10..219 23..227 227 31 Plus
Dyak\GE12035-PA 219 GE12035-PA 5..216 23..227 181 28.4 Plus
Dyak\GE13747-PA 216 GE13747-PA 5..213 23..227 167 30.1 Plus

GH12636.hyp Sequence

Translation from 299 to 1021

> GH12636.hyp
MEDALTVSGKPAACPVDQDCPYTIELIQPEDGEAVIAMLKTFFFKDEPLN
TFLDLGECKELEKYSLKPLPDNCSYKAVNKKGEIIGVFLNGLMRRPSPDD
VPEKAADSCEHPKFKKILSLMDHVEEQFNIFDVYPDEELILDGKILSVDT
NYRGLGIAGRLTERAYEYMRENGINVYHVLCSSHYSARVMEKLGFHEVFR
MQFADYKPQGEVVFKPAAPHVGIQVMAKEVGPAKAAQTKL*

GH12636.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:33:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dat-PA 240 CG3318-PA 1..240 1..240 1266 100 Plus
Dat-PB 275 CG3318-PB 36..275 1..240 1266 100 Plus
CG13759-PD 228 CG13759-PD 4..216 25..230 234 29.5 Plus
CG13759-PC 228 CG13759-PC 4..216 25..230 234 29.5 Plus
CG13759-PB 228 CG13759-PB 4..216 25..230 234 29.5 Plus