Clone GH12638 Report

Search the DGRC for GH12638

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:126
Well:38
Vector:pOT2
Associated Gene/TranscriptCpr67B-RA
Protein status:GH12638.pep: gold
Preliminary Size:1004
Sequenced Size:1016

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3672 2001-01-01 Release 2 assignment
CG3672 2001-10-10 Blastp of sequenced clone
CG3672 2003-01-01 Sim4 clustering to Release 3
Cpr67B 2008-04-29 Release 5.5 accounting
Cpr67B 2008-08-15 Release 5.9 accounting
Cpr67B 2008-12-18 5.12 accounting

Clone Sequence Records

GH12638.complete Sequence

1016 bp (1016 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060687

> GH12638.complete
CCAACTGGAGAATAGCGAATACACGTTGTGATACCTGGATAAACCACACA
TATAACTCATATTTCAAATCGAATCCACTATGAAGTGCTACATCTTGGCT
GCCCTGTTGCTGGCCACACTAGCCAGCGGTGAGAACATCTTCAAGATCAA
CATAACTCCCGAGGAGGCGCAGCAATTCCTTAACAGCGCCCAACTGCGTG
GCATTGGCGACATCGAGTATGCCCCGAAAACCGGTGAGAATCCCCTGCCC
GAGGCGCGCAACGAGAAGGGAGAGTTCGTCTACATGGGTCGTGTGATCGA
GCATCCCGAGGAGTATGTGGAGGAGCACTACGATGCCCATCAGTATCATG
GTCAGGATGGTTTGGGTCAATTTGCCTATGGCTATAGGGATTGGAACCAG
GGCAAGAACGAGAAGCGCGATGAGACGGGCAAAGTGACCGGATCGTACAA
GTATGTCCAACCACATGGCCGTGACTTTGTGGCCAACTATTATGCTGATA
AGACCGGTTTCCATGTGGAGGACAATCGTCCGGCACACCTTAAACTGCCG
GCCACTAAGACTCCGGCTGTCCTCAAGGCCGAGGAGGAGCACTTCAAGCT
GTGGGGTGAGCTGGCCGCCGCCGCTGGCCACAATCCCGATCCTTATGCCG
CCGAGTACCAGCAGGAGGGTCGCTACCAGCCCACTGAGCCCGAGTACCAG
CCCTACGTGCACGAGGAGCCGCCATATGTGCCCGGACCCGAGGAGACCGG
CGAGCCCAAGGGCTTCTTCTACGCCTTCGACTACAATGTCCCCCTGTTGC
GCAACAAGGAGGAGCGTGCCGAGCTCGAACGCCTGCGTGCCATCAACAAC
AAGGATGAGTAAGATTCAGATATTGATCTAGATCCTTATGGATTTGGTGG
ATCCATCGCATCGCCTTGTATAGGTCGTTCTGTAGAAAGTAGCTAAGACA
TTTTCACATATTTATTGAAATCCTTCGCAAAATAAATAGCAAACTTTAAA
AAAAAAAAAAAAAAAA

GH12638.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:12:48
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr67B.b 1436 Cpr67B.b 132..1131 1..1000 5000 100 Plus
Cpr67B-RA 1159 Cpr67B-RA 132..1131 1..1000 5000 100 Plus
Cpr67B.a 1672 Cpr67B.a 132..1131 1..1000 5000 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:06:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 9397198..9398094 112..997 4105 97.4 Plus
chr3L 24539361 chr3L 9396710..9396822 1..113 535 98.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:47:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:06:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9405289..9406177 112..1000 4445 100 Plus
3L 28110227 3L 9404810..9404922 1..113 565 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:36:36
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 9398389..9399277 112..1000 4445 100 Plus
3L 28103327 3L 9397910..9398022 1..113 565 100 Plus
Blast to na_te.dros performed on 2019-03-16 02:06:17 has no hits.

GH12638.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:07:23 Download gff for GH12638.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 9396710..9396821 1..112 98 -> Plus
chr3L 9397199..9398094 113..997 97   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:38:38 Download gff for GH12638.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr67B-RA 1..783 80..862 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:52:44 Download gff for GH12638.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr67B-RA 1..783 80..862 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:15:04 Download gff for GH12638.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr67B-RA 1..783 80..862 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:21:44 Download gff for GH12638.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr67B-RA 1..783 80..862 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:57:40 Download gff for GH12638.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr67B-RA 1..783 80..862 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:37:38 Download gff for GH12638.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr67B-RA 16..1012 1..997 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:52:43 Download gff for GH12638.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr67B-RA 16..1012 1..997 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:15:04 Download gff for GH12638.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr67B-RA 14..1010 1..997 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:21:44 Download gff for GH12638.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr67B-RA 16..1012 1..997 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:57:40 Download gff for GH12638.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr67B-RA 14..1010 1..997 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:07:23 Download gff for GH12638.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9404810..9404921 1..112 100 -> Plus
3L 9405290..9406174 113..997 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:07:23 Download gff for GH12638.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9404810..9404921 1..112 100 -> Plus
3L 9405290..9406174 113..997 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:07:23 Download gff for GH12638.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9404810..9404921 1..112 100 -> Plus
3L 9405290..9406174 113..997 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:15:04 Download gff for GH12638.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9397910..9398021 1..112 100 -> Plus
arm_3L 9398390..9399274 113..997 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:58:43 Download gff for GH12638.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9398390..9399274 113..997 100   Plus
3L 9397910..9398021 1..112 100 -> Plus

GH12638.pep Sequence

Translation from 79 to 861

> GH12638.pep
MKCYILAALLLATLASGENIFKINITPEEAQQFLNSAQLRGIGDIEYAPK
TGENPLPEARNEKGEFVYMGRVIEHPEEYVEEHYDAHQYHGQDGLGQFAY
GYRDWNQGKNEKRDETGKVTGSYKYVQPHGRDFVANYYADKTGFHVEDNR
PAHLKLPATKTPAVLKAEEEHFKLWGELAAAAGHNPDPYAAEYQQEGRYQ
PTEPEYQPYVHEEPPYVPGPEETGEPKGFFYAFDYNVPLLRNKEERAELE
RLRAINNKDE*

GH12638.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:34:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10693-PA 260 GF10693-PA 1..260 1..260 1343 97.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:34:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15372-PA 260 GG15372-PA 1..260 1..260 1354 97.7 Plus
Dere\GG16000-PA 216 GG16000-PA 35..137 88..188 146 35.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:34:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15135-PA 261 GH15135-PA 1..261 1..260 1209 86.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:11:25
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr67B-PA 260 CG3672-PA 1..260 1..260 1417 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:34:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12072-PA 261 GI12072-PA 1..261 1..260 1214 87 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:34:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22626-PA 260 GL22626-PA 1..260 1..260 1263 95 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:34:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17604-PA 260 GA17604-PA 1..260 1..260 1263 95 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:34:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25144-PA 246 GM25144-PA 1..246 1..260 1085 85 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:34:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14178-PA 259 GD14178-PA 1..259 1..260 1339 98.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:34:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13341-PA 261 GJ13341-PA 1..261 1..260 1218 87 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:34:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17155-PA 261 GK17155-PA 1..261 1..260 1270 92.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:34:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20834-PA 260 GE20834-PA 1..260 1..260 1359 98.5 Plus

GH12638.hyp Sequence

Translation from 79 to 861

> GH12638.hyp
MKCYILAALLLATLASGENIFKINITPEEAQQFLNSAQLRGIGDIEYAPK
TGENPLPEARNEKGEFVYMGRVIEHPEEYVEEHYDAHQYHGQDGLGQFAY
GYRDWNQGKNEKRDETGKVTGSYKYVQPHGRDFVANYYADKTGFHVEDNR
PAHLKLPATKTPAVLKAEEEHFKLWGELAAAAGHNPDPYAAEYQQEGRYQ
PTEPEYQPYVHEEPPYVPGPEETGEPKGFFYAFDYNVPLLRNKEERAELE
RLRAINNKDE*

GH12638.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:34:00
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr67B-PA 260 CG3672-PA 1..260 1..260 1417 100 Plus