Clone GH12681 Report

Search the DGRC for GH12681

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:126
Well:81
Vector:pOT2
Associated Gene/TranscriptAdam-RA
Protein status:GH12681.pep: gold
Preliminary Size:851
Sequenced Size:1227

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12131 2001-01-01 Release 2 assignment
CG12131 2001-07-04 Blastp of sequenced clone
CG12131 2003-01-01 Sim4 clustering to Release 3
Adam 2008-04-29 Release 5.5 accounting
Adam 2008-08-15 Release 5.9 accounting
Adam 2008-12-18 5.12 accounting

Clone Sequence Records

GH12681.complete Sequence

1227 bp (1227 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051457

> GH12681.complete
CTTGGGCACACTACAGATCCACAGAAATTTGGTTTTGGAAAATTCCTGAA
ATCGCTGCCGAGGCTGGAAACAAGTCGATCCCAGCACCATCCCATCCAGA
AGCACAAATCCCGCAAGCAAATAGGCAACCATTAACATGGCCGACGATTG
GGAATCCGCAGCAGACAGCGAGGTGGTCATCCGGCCGACTGCCGCCGCCA
GCGTAAACAAGTGGGAGGGCGAGGACGAGGATGAGGACATCAAGGACAGC
TGGGAGGATGAGGAGGAAAAAAAGGACGAGGAGAAGCCTACGAAAACAGA
AGCACCAGCCAAACCGAAGCCAAATAAGGCGCTAAAAGCCAAACTGGAAC
AGCAGGCGCTCCTAGAGGAGGAAGCGGAGGCAAAACGTTTGGCCAACCTA
TCGCCTGCAGAAAAGTTGGCTGAGAAGCTGCGATTGCAAAAAATCCAGGA
GGCCTCTGATCTCAAGCATGCCCAGGAAGCGTTCGGTGTGACGAGTACGT
GCGGAGGTCTTGACGCCTTCAACCCCGAGACCAAGGAGGAGTTCAAGGAA
TTTGGCGCAACGCTCAGCTGGAAGGTGGGCCAATTCCGCGAGTCGGAGCA
CTTCCCCCAATTTGTTGAGGATCTGGTGCGCAGCCTATGCGTGAATCTGA
GCGCTGCTGACATCAAAAAGGTCAAGATGAACGTGGAAATCTTGCACTCG
GAAAAGCTGAAGCTGGAAAAGGCCAATGCTAAAAAGCCCGCTGGAAAGGG
CAAGGGCAAGGTCACTCTCCGCACCGAAAACGACGACATTGACGGTTACC
AAAAGTACGGAAATGACTTCACCGAAGACTATGACGACTTCATGTGAATA
GGATCTATAAATGTAGCCCGCATATATCTAATTATTGAATGCATAGTTGC
TTGTTGAAGAGTTCTTCTTGTTAGAGATGCTGCGCAGGAATAAGAGTCCT
TTGTTAAATATAAAATGGCAGAACCTATATAAATATGTAAATATATATTT
ATATAACCATACATAACACAAAACGAGTTACATAGTCAAGTCAGGCAATC
AAGAAACCTCAACGAACACGCAAATCCAACTCCAAACCGAAAGAATATTT
AGGCAACTGACTTATGGCGACAGCACATGTATGTAGGTCGTATTCGGAAC
GGCTTCTTGTGAAATTCATTTTTGTATAAAGAATAAAACTACAGATCGAT
ATTAAACGAAAAAAAAAAAAAAAAAAA

GH12681.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:36:41
Subject Length Description Subject Range Query Range Score Percent Strand
Adam-RA 1400 Adam-RA 156..1375 1..1220 6070 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:07:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 5857988..5858411 785..1208 2120 100 Plus
chr2R 21145070 chr2R 5857432..5857721 358..647 1450 100 Plus
chr2R 21145070 chr2R 5856598..5856749 1..152 760 100 Plus
chr2R 21145070 chr2R 5857786..5857923 648..785 675 99.3 Plus
chr2R 21145070 chr2R 5857253..5857368 243..358 580 100 Plus
chr2R 21145070 chr2R 5856974..5857067 152..245 470 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:47:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:07:51
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9970474..9970909 785..1220 2150 99.5 Plus
2R 25286936 2R 9969918..9970207 358..647 1450 100 Plus
2R 25286936 2R 9969084..9969235 1..152 760 100 Plus
2R 25286936 2R 9970272..9970409 648..785 690 100 Plus
2R 25286936 2R 9969739..9969854 243..358 580 100 Plus
2R 25286936 2R 9969460..9969553 152..245 470 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:58:16
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 9971673..9972108 785..1220 2150 99.5 Plus
2R 25260384 2R 9971117..9971406 358..647 1450 100 Plus
2R 25260384 2R 9970283..9970434 1..152 760 100 Plus
2R 25260384 2R 9971471..9971608 648..785 690 100 Plus
2R 25260384 2R 9970938..9971053 243..358 580 100 Plus
2R 25260384 2R 9970659..9970752 152..245 470 100 Plus
Blast to na_te.dros performed on 2019-03-15 22:07:52 has no hits.

GH12681.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:08:38 Download gff for GH12681.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 5856598..5856749 1..152 100 -> Plus
chr2R 5856975..5857066 153..244 100 -> Plus
chr2R 5857255..5857368 245..358 100 -> Plus
chr2R 5857433..5857721 359..647 100 -> Plus
chr2R 5857786..5857922 648..784 99 -> Plus
chr2R 5857988..5858411 785..1208 92   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:38:45 Download gff for GH12681.complete
Subject Subject Range Query Range Percent Splice Strand
Adam-RA 1..711 137..847 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:27:33 Download gff for GH12681.complete
Subject Subject Range Query Range Percent Splice Strand
Adam-RA 1..711 137..847 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:10:00 Download gff for GH12681.complete
Subject Subject Range Query Range Percent Splice Strand
Adam-RA 1..711 137..847 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:00:48 Download gff for GH12681.complete
Subject Subject Range Query Range Percent Splice Strand
Adam-RA 1..711 137..847 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:13:14 Download gff for GH12681.complete
Subject Subject Range Query Range Percent Splice Strand
Adam-RA 1..711 137..847 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:27:05 Download gff for GH12681.complete
Subject Subject Range Query Range Percent Splice Strand
Adam-RA 125..1332 1..1208 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:27:33 Download gff for GH12681.complete
Subject Subject Range Query Range Percent Splice Strand
Adam-RA 125..1332 1..1208 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:10:00 Download gff for GH12681.complete
Subject Subject Range Query Range Percent Splice Strand
Adam-RA 156..1363 1..1208 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:00:49 Download gff for GH12681.complete
Subject Subject Range Query Range Percent Splice Strand
Adam-RA 125..1332 1..1208 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:13:14 Download gff for GH12681.complete
Subject Subject Range Query Range Percent Splice Strand
Adam-RA 156..1363 1..1208 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:08:38 Download gff for GH12681.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9969741..9969854 245..358 100 -> Plus
2R 9969084..9969235 1..152 100 -> Plus
2R 9969461..9969552 153..244 100 -> Plus
2R 9969919..9970207 359..647 100 -> Plus
2R 9970272..9970408 648..784 100 -> Plus
2R 9970474..9970897 785..1208 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:08:38 Download gff for GH12681.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9969741..9969854 245..358 100 -> Plus
2R 9969084..9969235 1..152 100 -> Plus
2R 9969461..9969552 153..244 100 -> Plus
2R 9969919..9970207 359..647 100 -> Plus
2R 9970272..9970408 648..784 100 -> Plus
2R 9970474..9970897 785..1208 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:08:38 Download gff for GH12681.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9969741..9969854 245..358 100 -> Plus
2R 9969084..9969235 1..152 100 -> Plus
2R 9969461..9969552 153..244 100 -> Plus
2R 9969919..9970207 359..647 100 -> Plus
2R 9970272..9970408 648..784 100 -> Plus
2R 9970474..9970897 785..1208 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:10:00 Download gff for GH12681.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5857246..5857359 245..358 100 -> Plus
arm_2R 5856966..5857057 153..244 100 -> Plus
arm_2R 5856589..5856740 1..152 100 -> Plus
arm_2R 5857424..5857712 359..647 100 -> Plus
arm_2R 5857777..5857913 648..784 100 -> Plus
arm_2R 5857979..5858402 785..1208 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:38:41 Download gff for GH12681.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9971118..9971406 359..647 100 -> Plus
2R 9971471..9971607 648..784 100 -> Plus
2R 9971673..9972096 785..1208 100   Plus
2R 9970283..9970434 1..152 100 -> Plus
2R 9970660..9970751 153..244 100 -> Plus
2R 9970940..9971053 245..358 100 -> Plus

GH12681.hyp Sequence

Translation from 136 to 846

> GH12681.hyp
MADDWESAADSEVVIRPTAAASVNKWEGEDEDEDIKDSWEDEEEKKDEEK
PTKTEAPAKPKPNKALKAKLEQQALLEEEAEAKRLANLSPAEKLAEKLRL
QKIQEASDLKHAQEAFGVTSTCGGLDAFNPETKEEFKEFGATLSWKVGQF
RESEHFPQFVEDLVRSLCVNLSAADIKKVKMNVEILHSEKLKLEKANAKK
PAGKGKGKVTLRTENDDIDGYQKYGNDFTEDYDDFM*

GH12681.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:34:34
Subject Length Description Subject Range Query Range Score Percent Strand
Adam-PB 236 CG12131-PB 1..236 1..236 1220 100 Plus
Adam-PA 236 CG12131-PA 1..236 1..236 1220 100 Plus

GH12681.pep Sequence

Translation from 136 to 846

> GH12681.pep
MADDWESAADSEVVIRPTAAASVNKWEGEDEDEDIKDSWEDEEEKKDEEK
PTKTEAPAKPKPNKALKAKLEQQALLEEEAEAKRLANLSPAEKLAEKLRL
QKIQEASDLKHAQEAFGVTSTCGGLDAFNPETKEEFKEFGATLSWKVGQF
RESEHFPQFVEDLVRSLCVNLSAADIKKVKMNVEILHSEKLKLEKANAKK
PAGKGKGKVTLRTENDDIDGYQKYGNDFTEDYDDFM*

GH12681.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:07:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13566-PA 237 GF13566-PA 1..237 1..236 840 83.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:07:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\Adam-PA 236 GG24124-PA 1..236 1..236 1196 97.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:07:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20349-PA 237 GH20349-PA 1..226 1..225 797 75.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:09
Subject Length Description Subject Range Query Range Score Percent Strand
eIF3j-PB 236 CG12131-PB 1..236 1..236 1220 100 Plus
eIF3j-PA 236 CG12131-PA 1..236 1..236 1220 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:07:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20018-PA 236 GI20018-PA 1..236 1..236 849 83.1 Plus
Dmoj\GI14543-PA 200 GI14543-PA 1..200 37..236 687 83.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:07:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16765-PA 240 GL16765-PA 1..240 1..236 813 75.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:07:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Adam-PA 240 GA11426-PA 1..240 1..236 813 75.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:07:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11120-PA 236 GM11120-PA 1..236 1..236 1200 97.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:07:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10704-PA 236 GD10704-PA 1..236 1..236 1200 97.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:07:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21266-PA 236 GJ21266-PA 1..236 1..236 832 80.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:07:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\Adam-PA 236 GK21662-PA 1..236 1..236 867 79.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:07:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19320-PA 236 GE19320-PA 1..236 1..236 1197 97.5 Plus