Clone GH12784 Report

Search the DGRC for GH12784

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:127
Well:84
Vector:pOT2
Associated Gene/TranscriptFer1HCH-RE
Protein status:GH12784.pep: gold
Sequenced Size:1177

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2216 2002-11-11 Blastp of sequenced clone
Fer1HCH 2008-04-29 Release 5.5 accounting
Fer1HCH 2008-08-15 Release 5.9 accounting
Fer1HCH 2008-12-18 5.12 accounting

Clone Sequence Records

GH12784.complete Sequence

1177 bp (1177 high quality bases) assembled on 2002-11-11

GenBank Submission: BT001419

> GH12784.complete
AAAGGCCTTAGCTCCACTGAAAAATCAGATTAAAGCTGTCAGCAGAAGAC
TACGTTCGACGATCAAAGATGGTGAAACTAATTGCTAGCCTGCTCCTGTT
GGCCGTGGTGGCCCAGGCCTATGGAGATTTCAAGTGCTCCCTGGCTGTTC
CTGAGATTACCAAGGACTGGGTGGACATGAAGGATGCCTGCATAAAGGGC
ATGCGCAATCAGATCCAGGAGGAGATCAACGCCTCCTACCAGTACTTGGC
CATGGGCGCCTACTTCTCCCGCGACACCGTCAACCGCCCTGGATTCGCCG
AGCACTTCTTCAAGGCCGCCAAGGAGGAACGTGAGCACGGATCCAAGCTG
GTGGAGTACCTGTCCATGCGCGGTCAACTGACCGAGGGAGTCAGCGATCT
GATCAATGTGCCGGTAAGTCGACGACTCGCCTAGAAAACCCAAAAGCCCA
GCTAATCCTGGCGAATCCCCCACAGACTGTGGCCAAGCAGGAGTGGACCG
ATGGTGCCGCCGCCCTGTCCGACGCCCTCGACCTGGAGATCAAGGTGACC
AAGTCCATCCGCAAGCTGATCCAGACCTGCGAGAACAAGCCCTACAACCA
CTACCACCTGGTGGACTACCTGACCGGTGTCTATCTGGAGGAGCAGCTCC
ACGGACAGCGCGAGCTCGCCGGCAAGCTGACCACTCTCAAGAAGATGATG
GACACCAACGGCGAACTGGGCGAGTTCCTGTTCGACAAGACCCTGTAAGG
AGGTGGAGATAGAGAAGGCGCAGCGCCCAGTCACGCATCAAAATTATCAG
CCAGTCGAGTTATCTGTTATCTGTCAGCCCAGAGAGCCTTCCCGAGGGTC
CGCTATTAAATCATCACCAGCCAAGTCGGCGACTGGCCAATAAATTATCC
GTTCGACTGCGATCCTCAAACCAGCACAGCAAAATTCCACGTCTGTTCTT
TCTTATCAACCACTTGTGATTTCCGTACACCTCGGGAGGGGGCTCCACAT
TATGCAATCGCCGAGATTTCGCCTAGGCTTAAGTGGAATCGCTCATTCGC
ATAGTAAGACACTCAGCACAACCCATTCAATACATCCTATATCTTTATAT
TTTTCTGTCAATTAGACGAGCAAGTTCTTAAATAAATAACAATATATATG
TAACGAAATAAAAAAAAAAAAAAAAAA

GH12784.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:34:53
Subject Length Description Subject Range Query Range Score Percent Strand
Fer1HCH-RE 1464 Fer1HCH-RE 303..1464 1..1162 5810 100 Plus
Fer1HCH-RC 1505 Fer1HCH-RC 807..1494 475..1162 3440 100 Plus
Fer1HCH-RD 1465 Fer1HCH-RD 767..1454 475..1162 3440 100 Plus
Fer1HCH-RC 1505 Fer1HCH-RC 440..807 46..413 1840 100 Plus
Fer1HCH-RD 1465 Fer1HCH-RD 400..767 46..413 1840 100 Plus
Fer1HCH-RC 1505 Fer1HCH-RC 303..350 1..48 240 100 Plus
Fer1HCH-RD 1465 Fer1HCH-RD 303..350 1..48 240 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:49:57
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 26208098..26209121 1159..136 5075 99.7 Minus
chr3R 27901430 chr3R 26209987..26210078 136..45 460 100 Minus
chr3R 27901430 chr3R 26210299..26210346 48..1 240 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:47:41 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:49:54
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30385570..30386596 1162..136 5135 100 Minus
3R 32079331 3R 30387463..30387553 136..46 455 100 Minus
3R 32079331 3R 30387775..30387822 48..1 240 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:09:35
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 30126401..30127427 1162..136 5135 100 Minus
3R 31820162 3R 30128294..30128384 136..46 455 100 Minus
3R 31820162 3R 30128606..30128653 48..1 240 100 Minus
Blast to na_te.dros performed 2019-03-16 13:49:55
Subject Length Description Subject Range Query Range Score Percent Strand
G3 4605 G3 G3 4605bp 639..682 8..52 114 75.6 Plus

GH12784.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:51:13 Download gff for GH12784.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 26208098..26209121 136..1159 99 <- Minus
chr3R 26209988..26210074 49..135 100 <- Minus
chr3R 26210299..26210346 1..48 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:38:58 Download gff for GH12784.complete
Subject Subject Range Query Range Percent Splice Strand
Fer1HCH-RC 1..345 69..413 100 == Plus
Fer1HCH-RC 346..618 476..748 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:06:18 Download gff for GH12784.complete
Subject Subject Range Query Range Percent Splice Strand
Fer1HCH-RC 346..618 476..748 100   Plus
Fer1HCH-RC 1..345 69..413 100 == Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:22:53 Download gff for GH12784.complete
Subject Subject Range Query Range Percent Splice Strand
Fer1HCH-RE 1..366 69..434 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:56:09 Download gff for GH12784.complete
Subject Subject Range Query Range Percent Splice Strand
Fer1HCH-RC 1..345 69..413 100 == Plus
Fer1HCH-RC 346..618 476..748 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:25:02 Download gff for GH12784.complete
Subject Subject Range Query Range Percent Splice Strand
Fer1HCH-RE 1..366 69..434 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:25:54 Download gff for GH12784.complete
Subject Subject Range Query Range Percent Splice Strand
Fer1HCH-RE 303..1461 1..1159 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:06:18 Download gff for GH12784.complete
Subject Subject Range Query Range Percent Splice Strand
Fer1HCH-RE 303..1461 1..1159 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:22:53 Download gff for GH12784.complete
Subject Subject Range Query Range Percent Splice Strand
Fer1HCH-RE 39..1197 1..1159 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:56:10 Download gff for GH12784.complete
Subject Subject Range Query Range Percent Splice Strand
Fer1HCH-RE 303..1461 1..1159 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:25:02 Download gff for GH12784.complete
Subject Subject Range Query Range Percent Splice Strand
Fer1HCH-RE 39..1197 1..1159 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:51:13 Download gff for GH12784.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30385573..30386596 136..1159 100 <- Minus
3R 30387464..30387550 49..135 100 <- Minus
3R 30387775..30387822 1..48 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:51:13 Download gff for GH12784.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30385573..30386596 136..1159 100 <- Minus
3R 30387464..30387550 49..135 100 <- Minus
3R 30387775..30387822 1..48 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:51:13 Download gff for GH12784.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30385573..30386596 136..1159 100 <- Minus
3R 30387464..30387550 49..135 100 <- Minus
3R 30387775..30387822 1..48 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:22:53 Download gff for GH12784.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 26211295..26212318 136..1159 100 <- Minus
arm_3R 26213186..26213272 49..135 100 <- Minus
arm_3R 26213497..26213544 1..48 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:28:35 Download gff for GH12784.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30126404..30127427 136..1159 100 <- Minus
3R 30128295..30128381 49..135 100 <- Minus
3R 30128606..30128653 1..48 100   Minus

GH12784.hyp Sequence

Translation from 68 to 433

> GH12784.hyp
MVKLIASLLLLAVVAQAYGDFKCSLAVPEITKDWVDMKDACIKGMRNQIQ
EEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSM
RGQLTEGVSDLINVPVSRRLA*

GH12784.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:35:34
Subject Length Description Subject Range Query Range Score Percent Strand
Fer1HCH-PE 121 CG2216-PE 1..121 1..121 614 100 Plus
Fer1HCH-PD 205 CG2216-PD 1..115 1..115 588 100 Plus
Fer1HCH-PC 205 CG2216-PC 1..115 1..115 588 100 Plus
Fer1HCH-PB 205 CG2216-PB 1..115 1..115 588 100 Plus
Fer1HCH-PA 205 CG2216-PA 1..115 1..115 588 100 Plus

GH12784.pep Sequence

Translation from 68 to 433

> GH12784.pep
MVKLIASLLLLAVVAQAYGDFKCSLAVPEITKDWVDMKDACIKGMRNQIQ
EEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSM
RGQLTEGVSDLINVPVSRRLA*

GH12784.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:53:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16185-PA 205 GF16185-PA 1..116 1..116 528 81.9 Plus
Dana\GF20872-PA 189 GF20872-PA 24..95 40..115 149 39.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:53:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11946-PA 205 GG11946-PA 1..116 1..116 611 97.4 Plus
Dere\GG19524-PA 189 GG19524-PA 23..87 40..104 152 43.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:53:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18415-PA 212 GH18415-PA 1..119 1..115 421 68.1 Plus
Dgri\GH24547-PA 190 GH24547-PA 25..86 41..102 137 40.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:42
Subject Length Description Subject Range Query Range Score Percent Strand
Fer1HCH-PE 121 CG2216-PE 1..121 1..121 614 100 Plus
Fer1HCH-PD 205 CG2216-PD 1..115 1..115 588 100 Plus
Fer1HCH-PC 205 CG2216-PC 1..115 1..115 588 100 Plus
Fer1HCH-PB 205 CG2216-PB 1..115 1..115 588 100 Plus
Fer1HCH-PA 205 CG2216-PA 1..115 1..115 588 100 Plus
Fer1HCH-PI 245 CG2216-PI 1..155 1..115 537 74.2 Plus
Fer1HCH-PG 242 CG2216-PG 1..152 1..115 530 75 Plus
Fer1HCH-PF 242 CG2216-PF 1..152 1..115 530 75 Plus
Fer1HCH-PJ 169 CG2216-PJ 1..79 37..115 409 100 Plus
Fer3HCH-PA 186 CG4349-PA 23..87 40..104 156 44.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:53:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24318-PA 194 GI24318-PA 1..103 14..116 366 67.3 Plus
Dmoj\GI16260-PA 190 GI16260-PA 23..94 40..115 140 38.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:53:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14055-PA 206 GL14055-PA 1..117 1..116 515 82.9 Plus
Dper\GL16490-PA 194 GL16490-PA 24..89 40..105 148 40.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:53:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15307-PC 206 GA15307-PC 1..117 1..116 515 82.9 Plus
Dpse\GA15307-PB 206 GA15307-PB 1..117 1..116 515 82.9 Plus
Dpse\GA15307-PA 206 GA15307-PA 1..117 1..116 515 82.9 Plus
Dpse\GA22605-PA 273 GA22605-PA 103..168 40..105 148 40.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:53:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12162-PA 205 GM12162-PA 1..116 1..116 606 96.6 Plus
Dsec\GM11516-PA 186 GM11516-PA 23..94 40..115 160 42.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:53:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17157-PA 205 GD17157-PA 1..116 1..116 610 97.4 Plus
Dsim\GD15908-PA 186 GD15908-PA 23..94 40..115 160 42.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:53:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10402-PA 212 GJ10402-PA 1..119 1..115 418 68.9 Plus
Dvir\GJ16902-PA 193 GJ16902-PA 23..85 40..102 142 41.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:53:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13135-PA 245 GK13135-PA 1..156 1..116 462 60.9 Plus
Dwil\GK25020-PA 202 GK25020-PA 28..99 41..110 156 41.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:53:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Fer1HCH-PA 205 GE23394-PA 1..116 1..116 612 97.4 Plus
Dyak\GE16178-PA 186 GE16178-PA 23..87 40..104 152 43.1 Plus