Clone GH12831 Report

Search the DGRC for GH12831

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:128
Well:31
Vector:pOT2
Associated Gene/TranscriptCG31199-RA
Protein status:GH12831.pep: gold
Preliminary Size:1106
Sequenced Size:928

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17837 2001-01-01 Release 2 assignment
CG31199 2002-06-10 Blastp of sequenced clone
CG31199 2008-04-29 Release 5.5 accounting
CG31199 2008-08-15 Release 5.9 accounting
CG31199 2008-12-18 5.12 accounting

Clone Sequence Records

GH12831.complete Sequence

928 bp (928 high quality bases) assembled on 2002-06-10

GenBank Submission: AY069113

> GH12831.complete
AATGCTTGGTAGAATCGCAGTTTTATTATTGCTCGTCGGTCTTTTTGGCC
CGGAAGTTCGGTCGGCGAAAGTGAATGATGACCAGTGCGGTGCATTCGAC
GAAGATCAGATGCTCAATATGCAAAGCACCTTCGCCATTCCCACGGAGCA
CCAGTGGGTGGCCCGGATAGTGTATGGCAAGGGGTTTGAGGGCAAGATTC
GGGACAATGGATGTCTGGGCGTGCTGGTATCGAAGCGCACTGTCTTGGCG
CCCGCCCACTGTTTTGTCCAGTACAACGGAGTAGCGGAGGCCTTCTCCGT
CCACCTGGGTGTCCACAACAAGAGTGCTCCGGTCGGAGTGCGAGTCTGCG
AAACGGATGGCTATTGCGTGCGTCCGTCGCAGGAAATCAAGCTGGCCGAG
ATAGCCATCCATCCGGACTACGACTCGCGAACCTTAAAGAACTCCCTGGC
GGTGCTGACTCTTCAGCGAGACGCAAAGATCTACCCAAATGTAATGCCAA
TTTGCATGCCACCTCCAAGCCTGCTCAACGAGACCCTGGTTGCTCAGACG
TTTGTAGTAGCTGGTCTTCGCGTCTTTGAGGACTTCAGACTAAAGACCTG
GGTAAACACGCTGAGTCGCGGCTTCTGTCAATCGAAGGTCAAGACGCTGG
TGACCAGCAGCAACACGGTTTGTGGCTACCACAAGCAACCGGTAGCTTAT
TACTTGGGCGCACCTCTAGTGGGGTTGCAGAAGAAGGGGCACGTCACTCA
GAACTACTACCTGGTGGGCATCATGATCGACTGGCGCTGGGAGAACAACC
GCATCATGTCCAGCTTTCTGGCCATACGCAACTACATGGACTTCATCCGA
CAGAACTCCAACTCACTGATTGTACGCTCCTGAACCTCGAATAAAGTTAA
GAGAAACGCCAAAAAAAAAAAAAAAAAA

GH12831.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:49:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG31199-RA 1313 CG31199-RA 144..1054 1..911 4555 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:36:24
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 16566715..16567443 910..182 3645 100 Minus
chr3R 27901430 chr3R 16567499..16567681 183..1 915 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:47:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:36:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20742799..20743528 911..182 3650 100 Minus
3R 32079331 3R 20743584..20743766 183..1 915 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:21:55
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 20483630..20484359 911..182 3650 100 Minus
3R 31820162 3R 20484415..20484597 183..1 915 100 Minus
Blast to na_te.dros performed on 2019-03-15 12:36:22 has no hits.

GH12831.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:37:07 Download gff for GH12831.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 16566715..16567442 183..910 100 <- Minus
chr3R 16567500..16567681 1..182 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:39:02 Download gff for GH12831.complete
Subject Subject Range Query Range Percent Splice Strand
CG31199-RA 1..882 2..883 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:24:35 Download gff for GH12831.complete
Subject Subject Range Query Range Percent Splice Strand
CG31199-RA 1..882 2..883 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:47:00 Download gff for GH12831.complete
Subject Subject Range Query Range Percent Splice Strand
CG31199-RA 1..882 2..883 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:15:12 Download gff for GH12831.complete
Subject Subject Range Query Range Percent Splice Strand
CG31199-RA 1..882 2..883 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:05:41 Download gff for GH12831.complete
Subject Subject Range Query Range Percent Splice Strand
CG31199-RA 1..882 2..883 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:52:09 Download gff for GH12831.complete
Subject Subject Range Query Range Percent Splice Strand
CG31199-RA 104..1013 1..910 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:24:35 Download gff for GH12831.complete
Subject Subject Range Query Range Percent Splice Strand
CG31199-RA 104..1013 1..910 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:47:00 Download gff for GH12831.complete
Subject Subject Range Query Range Percent Splice Strand
CG31199-RA 104..1013 1..910 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:15:12 Download gff for GH12831.complete
Subject Subject Range Query Range Percent Splice Strand
CG31199-RA 104..1013 1..910 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:05:41 Download gff for GH12831.complete
Subject Subject Range Query Range Percent Splice Strand
CG31199-RA 104..1013 1..910 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:37:07 Download gff for GH12831.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20742800..20743527 183..910 100 <- Minus
3R 20743585..20743766 1..182 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:37:07 Download gff for GH12831.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20742800..20743527 183..910 100 <- Minus
3R 20743585..20743766 1..182 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:37:07 Download gff for GH12831.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20742800..20743527 183..910 100 <- Minus
3R 20743585..20743766 1..182 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:47:00 Download gff for GH12831.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16568522..16569249 183..910 100 <- Minus
arm_3R 16569307..16569488 1..182 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:48:15 Download gff for GH12831.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20483631..20484358 183..910 100 <- Minus
3R 20484416..20484597 1..182 100   Minus

GH12831.hyp Sequence

Translation from 1 to 882

> GH12831.hyp
MLGRIAVLLLLVGLFGPEVRSAKVNDDQCGAFDEDQMLNMQSTFAIPTEH
QWVARIVYGKGFEGKIRDNGCLGVLVSKRTVLAPAHCFVQYNGVAEAFSV
HLGVHNKSAPVGVRVCETDGYCVRPSQEIKLAEIAIHPDYDSRTLKNSLA
VLTLQRDAKIYPNVMPICMPPPSLLNETLVAQTFVVAGLRVFEDFRLKTW
VNTLSRGFCQSKVKTLVTSSNTVCGYHKQPVAYYLGAPLVGLQKKGHVTQ
NYYLVGIMIDWRWENNRIMSSFLAIRNYMDFIRQNSNSLIVRS*

GH12831.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:35:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG31199-PA 293 CG31199-PA 1..293 1..293 1537 100 Plus
CG31200-PA 284 CG31200-PA 25..256 28..259 223 28.7 Plus
CG31205-PC 274 CG31205-PC 5..273 4..289 215 27 Plus
CG31205-PB 274 CG31205-PB 5..273 4..289 215 27 Plus
CG11313-PD 370 CG11313-PD 125..299 48..217 178 28.3 Plus

GH12831.pep Sequence

Translation from 1 to 882

> GH12831.pep
MLGRIAVLLLLVGLFGPEVRSAKVNDDQCGAFDEDQMLNMQSTFAIPTEH
QWVARIVYGKGFEGKIRDNGCLGVLVSKRTVLAPAHCFVQYNGVAEAFSV
HLGVHNKSAPVGVRVCETDGYCVRPSQEIKLAEIAIHPDYDSRTLKNSLA
VLTLQRDAKIYPNVMPICMPPPSLLNETLVAQTFVVAGLRVFEDFRLKTW
VNTLSRGFCQSKVKTLVTSSNTVCGYHKQPVAYYLGAPLVGLQKKGHVTQ
NYYLVGIMIDWRWENNRIMSSFLAIRNYMDFIRQNSNSLIVRS*

GH12831.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:45:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18318-PA 292 GF18318-PA 1..292 1..293 1194 72 Plus
Dana\GF18317-PA 284 GF18317-PA 23..254 28..259 215 28.8 Plus
Dana\GF16689-PA 823 GF16689-PA 9..233 21..259 154 24.8 Plus
Dana\GF16189-PA 413 GF16189-PA 139..276 49..188 147 33.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:45:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15203-PA 292 GG15203-PA 1..292 1..293 1433 90.4 Plus
Dere\GG15191-PA 284 GG15191-PA 25..283 28..286 252 29.8 Plus
Dere\GG24066-PA 309 GG24066-PA 63..307 24..286 193 23.9 Plus
Dere\GG11533-PA 385 GG11533-PA 138..276 45..188 163 30.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:46:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12943-PA 260 GH12943-PA 1..260 37..293 718 54.2 Plus
Dgri\GH14240-PA 284 GH14240-PA 27..283 28..288 272 28.1 Plus
Dgri\GH16014-PA 285 GH16014-PA 7..280 11..286 229 27.2 Plus
Dgri\GH14213-PA 294 GH14213-PA 26..285 28..287 214 26.4 Plus
Dgri\GH18659-PA 371 GH18659-PA 106..280 28..198 156 28.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:11:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG31199-PA 293 CG31199-PA 1..293 1..293 1537 100 Plus
CG31200-PA 284 CG31200-PA 25..256 28..259 223 28.7 Plus
CG31205-PC 274 CG31205-PC 5..273 4..289 215 27 Plus
CG31205-PB 274 CG31205-PB 5..273 4..289 215 27 Plus
CG11313-PD 370 CG11313-PD 125..299 48..217 178 28.3 Plus
CG3505-PA 360 CG3505-PA 117..323 49..248 177 31.1 Plus
CG11313-PC 367 CG11313-PC 125..296 48..217 177 28.2 Plus
CG5909-PA 381 CG5909-PA 136..274 45..188 162 29.7 Plus
CG10232-PD 509 CG10232-PD 261..432 43..213 151 28.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:46:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22160-PA 293 GI22160-PA 17..291 19..291 795 54.2 Plus
Dmoj\GI22159-PA 288 GI22159-PA 23..285 21..288 230 25.7 Plus
Dmoj\GI10684-PA 372 GI10684-PA 127..340 49..259 157 28.1 Plus
Dmoj\GI22268-PA 380 GI22268-PA 156..312 71..224 148 25.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:46:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27132-PA 291 GL27132-PA 4..291 3..293 1140 72.9 Plus
Dper\GL18574-PA 293 GL18574-PA 6..260 11..255 227 27.6 Plus
Dper\GL27131-PA 286 GL27131-PA 23..255 26..258 207 26.6 Plus
Dper\GL11766-PA 376 GL11766-PA 125..241 52..170 162 34.4 Plus
Dper\GL11854-PA 352 GL11854-PA 85..284 24..224 152 26.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:46:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16086-PA 291 GA16086-PA 4..291 3..293 1148 72.9 Plus
Dpse\GA30055-PA 263 GA30055-PA 4..261 18..286 273 29.7 Plus
Dpse\GA25698-PA 293 GA25698-PA 6..260 11..255 237 28.4 Plus
Dpse\GA30057-PA 295 GA30057-PA 47..295 27..289 229 28.3 Plus
Dpse\GA16087-PA 286 GA16087-PA 8..255 7..258 217 27.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:46:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23166-PA 293 GM23166-PA 1..293 1..293 1464 95.6 Plus
Dsec\GM23165-PA 284 GM23165-PA 25..256 28..259 213 28.2 Plus
Dsec\GM23130-PA 298 GM23130-PA 56..297 24..287 210 25.5 Plus
Dsec\GM10374-PA 385 GM10374-PA 138..276 45..188 159 29.7 Plus
Dsec\GM21637-PA 306 GM21637-PA 39..179 23..170 156 27.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:46:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20039-PA 293 GD20039-PA 1..293 1..293 1535 96.6 Plus
Dsim\GD20038-PA 284 GD20038-PA 25..256 28..259 212 27.4 Plus
Dsim\GD19368-PA 298 GD19368-PA 56..297 24..287 203 24.8 Plus
Dsim\GD19370-PA 276 GD19370-PA 6..265 9..289 185 27.6 Plus
Dsim\GD19306-PA 297 GD19306-PA 45..210 45..212 155 27.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:46:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24282-PA 287 GJ24282-PA 7..286 9..287 759 51.6 Plus
Dvir\GJ24279-PA 287 GJ24279-PA 7..285 9..286 758 52.1 Plus
Dvir\GJ24278-PA 290 GJ24278-PA 30..289 21..286 216 25.8 Plus
Dvir\GJ24280-PA 290 GJ24280-PA 30..289 21..286 212 25.5 Plus
Dvir\GJ21978-PA 296 GJ21978-PA 73..214 70..209 173 30.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:46:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22703-PA 286 GK22703-PA 4..286 1..293 890 58.7 Plus
Dwil\GK21103-PA 272 GK21103-PA 1..272 7..287 238 26.5 Plus
Dwil\GK22701-PA 285 GK22701-PA 26..284 28..288 232 26.8 Plus
Dwil\GK11884-PA 375 GK11884-PA 105..304 25..225 161 26.4 Plus
Dwil\GK11130-PA 392 GK11130-PA 138..360 49..258 148 28.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:46:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25045-PA 292 GE25045-PA 1..292 1..293 1380 90.8 Plus
Dyak\GE25044-PA 284 GE25044-PA 25..256 28..259 220 28.6 Plus
Dyak\GE25680-PA 292 GE25680-PA 56..290 24..286 206 24.7 Plus
Dyak\GE24249-PA 360 GE24249-PA 117..354 49..282 181 28 Plus
Dyak\GE11731-PA 371 GE11731-PA 103..243 23..170 158 28.4 Plus