Clone GH12958 Report

Search the DGRC for GH12958

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:129
Well:58
Vector:pOT2
Associated Gene/TranscriptVha36-1-RA
Protein status:GH12958.pep: gold
Preliminary Size:1054
Sequenced Size:1060

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8186 2001-01-01 Release 2 assignment
CG8186 2001-11-12 Blastp of sequenced clone
CG8186 2003-01-01 Sim4 clustering to Release 3
Vha36 2008-04-29 Release 5.5 accounting
Vha36 2008-08-15 Release 5.9 accounting
Vha36 2008-12-18 5.12 accounting

Clone Sequence Records

GH12958.complete Sequence

1060 bp (1060 high quality bases) assembled on 2001-11-12

GenBank Submission: AY069116

> GH12958.complete
TTCTGCGACGGTTGCAGTTTTCTTGATACGCAGTTGAAAATTGTTTAGTC
CAGCCAATTACCATCCGAAAAAAACAGCAAAATGTCCGGAAAAGATAGGC
TACCGATTTTCCCGTCCCGTGGTGCCCAGATGTTGATGAAGGCCCGTCTG
GCTGGAGCCCAGAAAGGTCACGGTCTGCTCAAGAAGAAGGCGGATGCCCT
GCAGATGCGATTCCGTTTGATTCTGGGCAAGATCATCGAGACCAAGACCC
TGATGGGTGATGTTATGAAAGAGGCAGCCTTCTCGCTGGCGGAGGCCAAA
TTCACGTCTGGCGACATCAACCAAGTGGTGCTGCAAAACGTGACCAAGGC
CCAGATCAAGATCCGCACCAAGAAGGACAACGTGGCTGGTGTCACTCTGC
CCGTTTTCGAGTCCTACCAGGACGGATCCGACACCTACGAACTGGCCGGT
CTAGCCCGTGGTGGTCAGCAGCTGGCCAAGCTGAAGAAGAACTACCAAAG
CGCCGTTAAACTGCTCGTGGAGCTGGCCTCGCTGCAGACCTCATTCGTCA
CCCTGGACGAGGTGATCAAGATCACCAACCGTCGTGTGAACGCCATTGAG
CATGTGATCATCCCCCGAATCGATAGGACTTTGGCCTACATCATCTCGGA
GCTGGACGAGCTCGAGCGTGAGGAGTTCTACCGACTGAAGAAGATCCAGG
ACAAGAAGCGCGAGGCACGCATCAAGGCCGACGCCAAGAAGGCGGAGTTG
CTGCAGCAGGGCATCGATGTGCGCCAGCAGGCCAATATCCTGGATGAGGG
CGATGACGACGTGCTGTTCTAAGTATTACCTTGGATGTGTTTATTCCAGC
AATATTATTGTTAAACTATTTTCTGTTCTGTATCCGTTTCCATATTGTAA
TTCGCAAAGGGCAAGCCACAAACTTAATTGTACCTATGTAGCAAAAGTGT
GTAGACTATTCCAATAAGCAGAAAAGTATGTATTCCATTTTTGTAGTGTA
GTGTAAGCTGCGCAAATCATGCATTAAAGTCTTGTTGTATCATAAAAAAA
AAAAAAAAAA

GH12958.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:56:31
Subject Length Description Subject Range Query Range Score Percent Strand
Vha36-RA 1082 Vha36-RA 40..1082 1..1043 5215 100 Plus
CG8310-RA 1069 CG8310-RA 206..718 109..621 1230 82.6 Plus
CG8310.a 1237 CG8310.a 374..886 109..621 1230 82.6 Plus
CG8310-RA 1069 CG8310-RA 746..818 649..721 260 90.4 Plus
CG8310.a 1237 CG8310.a 914..986 649..721 260 90.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:46:17
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 11428606..11429648 1..1043 5215 100 Plus
chrX 22417052 chrX 2473368..2473731 602..239 860 82.4 Minus
chrX 22417052 chrX 2473785..2473901 240..124 285 82.9 Minus
chrX 22417052 chrX 2473188..2473305 721..604 275 82.2 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:48:07 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:46:15
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 15541456..15542499 1..1044 5220 100 Plus
X 23542271 X 2579579..2579942 602..239 860 82.4 Minus
X 23542271 X 2579996..2580112 240..124 285 82.9 Minus
X 23542271 X 2579399..2579516 721..604 275 82.2 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:21:29
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 15542655..15543698 1..1044 5220 100 Plus
X 23527363 X 2587677..2588040 602..239 860 82.4 Minus
X 23527363 X 2588094..2588210 240..124 285 82.9 Minus
X 23527363 X 2587497..2587569 721..649 260 90.4 Minus
Blast to na_te.dros performed on 2019-03-15 15:46:16 has no hits.

GH12958.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:46:58 Download gff for GH12958.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 11428606..11429648 1..1043 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:39:21 Download gff for GH12958.complete
Subject Subject Range Query Range Percent Splice Strand
Vha36-RA 1..741 82..822 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:27:36 Download gff for GH12958.complete
Subject Subject Range Query Range Percent Splice Strand
Vha36-1-RA 1..741 82..822 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:39:50 Download gff for GH12958.complete
Subject Subject Range Query Range Percent Splice Strand
Vha36-1-RA 1..741 82..822 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:55:46 Download gff for GH12958.complete
Subject Subject Range Query Range Percent Splice Strand
Vha36-RA 1..741 82..822 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:15:23 Download gff for GH12958.complete
Subject Subject Range Query Range Percent Splice Strand
Vha36-1-RA 1..741 82..822 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:05:15 Download gff for GH12958.complete
Subject Subject Range Query Range Percent Splice Strand
Vha36-RA 40..1082 1..1043 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:27:36 Download gff for GH12958.complete
Subject Subject Range Query Range Percent Splice Strand
Vha36-1-RA 40..1082 1..1043 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:39:50 Download gff for GH12958.complete
Subject Subject Range Query Range Percent Splice Strand
Vha36-1-RA 22..1064 1..1043 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:55:46 Download gff for GH12958.complete
Subject Subject Range Query Range Percent Splice Strand
Vha36-RA 40..1082 1..1043 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:15:23 Download gff for GH12958.complete
Subject Subject Range Query Range Percent Splice Strand
Vha36-1-RA 22..1064 1..1043 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:46:58 Download gff for GH12958.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15541456..15542498 1..1043 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:46:58 Download gff for GH12958.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15541456..15542498 1..1043 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:46:58 Download gff for GH12958.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15541456..15542498 1..1043 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:39:50 Download gff for GH12958.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11428961..11430003 1..1043 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:31:13 Download gff for GH12958.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15542655..15543697 1..1043 100   Plus

GH12958.hyp Sequence

Translation from 81 to 821

> GH12958.hyp
MSGKDRLPIFPSRGAQMLMKARLAGAQKGHGLLKKKADALQMRFRLILGK
IIETKTLMGDVMKEAAFSLAEAKFTSGDINQVVLQNVTKAQIKIRTKKDN
VAGVTLPVFESYQDGSDTYELAGLARGGQQLAKLKKNYQSAVKLLVELAS
LQTSFVTLDEVIKITNRRVNAIEHVIIPRIDRTLAYIISELDELEREEFY
RLKKIQDKKREARIKADAKKAELLQQGIDVRQQANILDEGDDDVLF*

GH12958.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:37:32
Subject Length Description Subject Range Query Range Score Percent Strand
Vha36-1-PA 246 CG8186-PA 1..246 1..246 1204 100 Plus
Vha36-3-PC 249 CG8310-PC 1..249 1..246 1015 83.9 Plus
Vha36-3-PB 249 CG8310-PB 1..249 1..246 1015 83.9 Plus
Vha36-2-PA 373 CG13167-PA 1..214 1..214 388 40.5 Plus

GH12958.pep Sequence

Translation from 81 to 821

> GH12958.pep
MSGKDRLPIFPSRGAQMLMKARLAGAQKGHGLLKKKADALQMRFRLILGK
IIETKTLMGDVMKEAAFSLAEAKFTSGDINQVVLQNVTKAQIKIRTKKDN
VAGVTLPVFESYQDGSDTYELAGLARGGQQLAKLKKNYQSAVKLLVELAS
LQTSFVTLDEVIKITNRRVNAIEHVIIPRIDRTLAYIISELDELEREEFY
RLKKIQDKKREARIKADAKKAELLQQGIDVRQQANILDEGDDDVLF*

GH12958.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 10:35:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11142-PA 246 GF11142-PA 1..246 1..246 1252 98.4 Plus
Dana\GF21946-PA 249 GF21946-PA 1..249 1..246 1067 84.7 Plus
Dana\GF12834-PA 348 GF12834-PA 1..214 1..214 382 38.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 10:35:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20533-PA 246 GG20533-PA 1..246 1..246 1260 99.6 Plus
Dere\GG12609-PA 249 GG12609-PA 1..249 1..246 1058 83.9 Plus
Dere\GG20264-PA 381 GG20264-PA 1..214 1..214 387 39.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 10:35:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19969-PA 246 GH19969-PA 1..246 1..246 1244 97.2 Plus
Dgri\GH12748-PA 250 GH12748-PA 1..250 1..246 1059 83.2 Plus
Dgri\GH22755-PA 340 GH22755-PA 1..214 1..214 395 37.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:29:37
Subject Length Description Subject Range Query Range Score Percent Strand
Vha36-1-PA 246 CG8186-PA 1..246 1..246 1204 100 Plus
Vha36-3-PC 249 CG8310-PC 1..249 1..246 1015 83.9 Plus
Vha36-3-PB 249 CG8310-PB 1..249 1..246 1015 83.9 Plus
Vha36-2-PA 373 CG13167-PA 1..214 1..214 388 40.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 10:35:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20255-PA 246 GI20255-PA 1..246 1..246 1245 98 Plus
Dmoj\GI15892-PA 250 GI15892-PA 1..250 1..246 1076 84.4 Plus
Dmoj\GI18533-PA 324 GI18533-PA 1..213 1..213 360 37.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 10:35:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20077-PA 246 GL20077-PA 1..246 1..246 1250 98.4 Plus
Dper\GL14446-PA 249 GL14446-PA 1..249 1..246 1061 83.5 Plus
Dper\GL10813-PA 339 GL10813-PA 1..214 1..214 392 40.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:35:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20878-PA 246 GA20878-PA 1..246 1..246 1250 98.4 Plus
Dpse\GA20975-PA 249 GA20975-PA 1..249 1..246 1061 83.5 Plus
Dpse\GA12092-PA 339 GA12092-PA 1..214 1..214 391 40.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 10:35:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18874-PA 305 GM18874-PA 63..305 4..246 997 81.3 Plus
Dsec\GM21623-PA 206 GM21623-PA 1..206 1..246 918 78.5 Plus
Dsec\GM21350-PA 360 GM21350-PA 1..214 1..214 387 40 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 10:35:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11125-PA 260 GD11125-PA 1..227 1..227 1148 97.4 Plus
Dsim\GD10848-PA 360 GD10848-PA 1..214 1..214 387 40 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 10:35:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20208-PA 248 GJ20208-PA 1..246 1..246 1241 97.6 Plus
Dvir\GJ16639-PA 250 GJ16639-PA 1..250 1..246 1067 83.2 Plus
Dvir\GJ21402-PA 332 GJ21402-PA 1..214 1..214 389 39.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 10:35:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23028-PA 247 GK23028-PA 1..247 1..246 1242 98 Plus
Dwil\GK24913-PA 250 GK24913-PA 1..250 1..246 1068 84.4 Plus
Dwil\GK22115-PA 358 GK22115-PA 1..217 1..214 409 39.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 10:35:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11717-PA 246 GE11717-PA 1..246 1..246 1265 100 Plus
Dyak\GE16940-PA 148 GE16940-PA 1..142 1..142 680 91.5 Plus
Dyak\GE12423-PA 372 GE12423-PA 1..214 1..214 380 39.1 Plus