Clone GH13185 Report

Search the DGRC for GH13185

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:131
Well:85
Vector:pOT2
Associated Gene/TranscriptSnapin-RA
Protein status:GH13185.pep2: gold GH13185.pep: gold
Preliminary Size:1320
Sequenced Size:1249

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9958 2001-01-01 Release 2 assignment
CG9960 2001-01-01 Release 2 assignment
CG32951 2001-11-29 Blastp of sequenced clone
CG32951 2003-01-01 Sim4 clustering to Release 3
CG9960 2008-04-29 Release 5.5 accounting
CG9960 2008-08-15 Release 5.9 accounting
snapin 2008-08-15 Release 5.9 accounting
CG9960 2008-12-18 5.12 accounting
snapin 2008-12-18 5.12 accounting

Clone Sequence Records

GH13185.complete Sequence

1249 bp (1249 high quality bases) assembled on 2001-11-29

GenBank Submission: AY069120.1

> GH13185.complete
AATTCTGCAATGGATTCGGACAGCACCGTGACTTCCTTGGAGGAGAACAC
GGAGAACTTTTGCACGAATCCCACGCGCGACATCCTCGCCGAGGGCATCA
CCAATCTCTTCAAGCCGACGATCGAGCGGTTGGACGAGCGCGTGGCCTCC
ACCATCCAGCTGCAGGCTGAGCTGCGTGGCCAACTGGATGCACTGGCCGC
CCAGCTGAGGGACATCGAAAAGGCGCAGAGTCAGATACCCGAGTTCGCGG
ACAAGGTGAAGGAGCTGCTGAACGTCAAGCACAAGGTGACGGTCATAAGC
AACGTGTTGGTGACCAGCCAGGAGCGGCTGACGGGTCTGCACAAGCTGAT
AGAGAAGGAGCAGCGGCGGCGACAGGCGCTTCTCGATTCCGCGCTCAGCA
CCAACATATCCTAAATCCAATTACTGTTCGTCATGGAGACGCCCTACACC
GACCACTTGAGCCCAGAAGATTTCGAGCACGTTTACGAGCCAGCGGAGGA
CTCGTTCCTGCTGCTGGATGCCCTGGAAAAGGATCTGGAGTACCTGGACC
GGCTACAGCCGAGTCTCTGCGTCGAACTGGGCTCCGGTTCGGGTGTGATC
ATCACGGCGCTGGCCAAGAAACTGGCTGGCTTTTCGCTGTGCCTAGCTAC
GGATATCAATCCCAAAGCCTGCAATGCCACTCGAAGAACTGCGACTCGGA
ATGGCGCTCGCTTGGATAGCATTCGCTGCAGCCTAGCGGATGCACTGCGT
CCGCGATCCGTGGACGTGCTGCTCTTCAATCCGCCCTATGTAGTCACCAG
TGACGAGGAGCTGCAGACGCAACAGTTCGATTCGCACAGCGAATCCTCAA
CGGATCGCAATCTGGTTTTCTCCTGGGCTGGTGGACAGGACGGGCGACGC
GTCACGGACATTCTACTCAAGCAATTGGATGACATTCTTTCGCCTCGAGG
CGTGCTCTACCTACTCCTGCTGCGGGAGAACAAGCCGGAGGAGATTATCA
AATACTTAGAGGGCCTCCAGTTCCGGGCTGTTAAGTTCATGGAGCGACGC
ATTCCTGGCGAGCATTTGTGCATACTGAAGGTCACCAGGTACTTGGCATC
ATCATGACTCGTGCAATAGCATCAAATTAAAGTTGTATTTTAATTAAAAG
ATAAACTTTTTTAGGCGTTTATTCTTAAATTTGATACTAAATAATATGGA
GAATAATTTTAATAAAAGTTGAAATAAATGAAAAAAAAAAAAAAAAAAA

GH13185.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:52:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG9960-RA 1284 CG9960-RA 55..1284 1..1230 6150 100 Plus
snapin-RA 1284 snapin-RA 55..1284 1..1230 6150 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:46:57
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 2758151..2759379 1229..1 6025 99.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:48:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:46:55
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2758420..2759656 1237..1 6170 99.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:18:25
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2758420..2759656 1237..1 6170 99.9 Minus
Blast to na_te.dros performed on 2019-03-16 12:46:56 has no hits.

GH13185.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:47:48 Download gff for GH13185.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 2758150..2759379 1..1230 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:39:50 Download gff for GH13185.complete
Subject Subject Range Query Range Percent Splice Strand
CG9960-RA 1..675 433..1107 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:22:48 Download gff for GH13185.complete
Subject Subject Range Query Range Percent Splice Strand
CG9960-RA 1..675 433..1107 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 14:05:37 Download gff for GH13185.complete
Subject Subject Range Query Range Percent Splice Strand
CG9960-RA 1..675 433..1107 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:49:10 Download gff for GH13185.complete
Subject Subject Range Query Range Percent Splice Strand
CG9960-RA 1..675 433..1107 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:55:14 Download gff for GH13185.complete
Subject Subject Range Query Range Percent Splice Strand
CG9960-RA 1..675 433..1107 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:57:38 Download gff for GH13185.complete
Subject Subject Range Query Range Percent Splice Strand
snapin-RA 55..1284 1..1230 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:22:48 Download gff for GH13185.complete
Subject Subject Range Query Range Percent Splice Strand
snapin-RA 55..1284 1..1230 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 14:05:37 Download gff for GH13185.complete
Subject Subject Range Query Range Percent Splice Strand
CG9960-RA 22..1251 1..1230 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:49:10 Download gff for GH13185.complete
Subject Subject Range Query Range Percent Splice Strand
snapin-RA 55..1284 1..1230 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:55:14 Download gff for GH13185.complete
Subject Subject Range Query Range Percent Splice Strand
CG9960-RA 22..1251 1..1230 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:47:48 Download gff for GH13185.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2758427..2759656 1..1230 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:47:48 Download gff for GH13185.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2758427..2759656 1..1230 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:47:48 Download gff for GH13185.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2758427..2759656 1..1230 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:05:37 Download gff for GH13185.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2758427..2759656 1..1230 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:25:46 Download gff for GH13185.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2758427..2759656 1..1230 100   Minus

GH13185.pep2 Sequence

Translation from 9 to 413

> GH13185.pep2
MDSDSTVTSLEENTENFCTNPTRDILAEGITNLFKPTIERLDERVASTIQ
LQAELRGQLDALAAQLRDIEKAQSQIPEFADKVKELLNVKHKVTVISNVL
VTSQERLTGLHKLIEKEQRRRQALLDSALSTNIS*

GH13185.pep2 Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 12:18:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13874-PA 136 GF13874-PA 4..136 2..134 637 92.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 12:18:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24495-PA 134 GG24495-PA 1..134 1..134 684 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 12:18:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10569-PA 136 GH10569-PA 4..136 2..134 631 91.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:08:53
Subject Length Description Subject Range Query Range Score Percent Strand
Snapin-PA 134 CG9958-PA 1..134 1..134 652 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 12:18:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22913-PA 136 GI22913-PA 4..136 2..134 644 93.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 12:18:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26447-PA 136 GL26447-PA 4..136 2..134 645 94.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 12:18:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17213-PA 136 GA17213-PA 4..136 2..134 645 94.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 12:18:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18203-PA 134 GM18203-PA 1..134 1..134 678 99.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 12:18:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22807-PA 134 GD22807-PA 1..134 1..134 684 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 12:18:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23460-PA 136 GJ23460-PA 4..136 2..134 633 91 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 12:18:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24481-PA 136 GK24481-PA 4..136 2..134 614 88 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 12:18:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15040-PA 134 GE15040-PA 1..134 1..134 684 100 Plus

GH13185.hyp Sequence

Translation from 432 to 1106

> GH13185.hyp
METPYTDHLSPEDFEHVYEPAEDSFLLLDALEKDLEYLDRLQPSLCVELG
SGSGVIITALAKKLAGFSLCLATDINPKACNATRRTATRNGARLDSIRCS
LADALRPRSVDVLLFNPPYVVTSDEELQTQQFDSHSESSTDRNLVFSWAG
GQDGRRVTDILLKQLDDILSPRGVLYLLLLRENKPEEIIKYLEGLQFRAV
KFMERRIPGEHLCILKVTRYLASS*

GH13185.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:52:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG9960-PA 224 CG9960-PA 1..224 1..224 1146 100 Plus

GH13185.pep Sequence

Translation from 432 to 1106

> GH13185.pep
METPYTDHLSPEDFEHVYEPAEDSFLLLDALEKDLEYLDRLQPSLCVELG
SGSGVIITALAKKLAGFSLCLATDINPKACNATRRTATRNGARLDSIRCS
LADALRPRSVDVLLFNPPYVVTSDEELQTQQFDSHSESSTDRNLVFSWAG
GQDGRRVTDILLKQLDDILSPRGVLYLLLLRENKPEEIIKYLEGLQFRAV
KFMERRIPGEHLCILKVTRYLASS*

GH13185.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:44:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20002-PA 222 GF20002-PA 1..222 1..222 877 77.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:44:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24496-PA 224 GG24496-PA 1..224 1..224 1107 94.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:44:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10570-PA 220 GH10570-PA 1..217 1..219 791 75 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:41:05
Subject Length Description Subject Range Query Range Score Percent Strand
HemK2-PA 224 CG9960-PA 1..224 1..224 1146 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:44:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22924-PA 220 GI22924-PA 1..217 1..219 826 77.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:45:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26448-PA 226 GL26448-PA 1..223 1..219 775 74.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:45:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28866-PA 226 GA28866-PA 1..223 1..219 775 74.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:45:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18204-PA 224 GM18204-PA 1..224 1..224 1146 97.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:45:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22808-PA 224 GD22808-PA 1..224 1..224 1154 98.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:45:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23471-PA 224 GJ23471-PA 1..221 1..219 893 76.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:45:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19357-PA 217 GK19357-PA 1..214 1..219 857 73.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:45:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15042-PA 224 GE15042-PA 1..224 1..224 1107 94.6 Plus