Associations are from manual ordering of a clone or by a periodic analysis.
Clone Sequence Records
GH13185.complete Sequence
1249 bp (1249 high quality bases) assembled on 2001-11-29
GenBank Submission: AY069120.1
> GH13185.complete
AATTCTGCAATGGATTCGGACAGCACCGTGACTTCCTTGGAGGAGAACAC
GGAGAACTTTTGCACGAATCCCACGCGCGACATCCTCGCCGAGGGCATCA
CCAATCTCTTCAAGCCGACGATCGAGCGGTTGGACGAGCGCGTGGCCTCC
ACCATCCAGCTGCAGGCTGAGCTGCGTGGCCAACTGGATGCACTGGCCGC
CCAGCTGAGGGACATCGAAAAGGCGCAGAGTCAGATACCCGAGTTCGCGG
ACAAGGTGAAGGAGCTGCTGAACGTCAAGCACAAGGTGACGGTCATAAGC
AACGTGTTGGTGACCAGCCAGGAGCGGCTGACGGGTCTGCACAAGCTGAT
AGAGAAGGAGCAGCGGCGGCGACAGGCGCTTCTCGATTCCGCGCTCAGCA
CCAACATATCCTAAATCCAATTACTGTTCGTCATGGAGACGCCCTACACC
GACCACTTGAGCCCAGAAGATTTCGAGCACGTTTACGAGCCAGCGGAGGA
CTCGTTCCTGCTGCTGGATGCCCTGGAAAAGGATCTGGAGTACCTGGACC
GGCTACAGCCGAGTCTCTGCGTCGAACTGGGCTCCGGTTCGGGTGTGATC
ATCACGGCGCTGGCCAAGAAACTGGCTGGCTTTTCGCTGTGCCTAGCTAC
GGATATCAATCCCAAAGCCTGCAATGCCACTCGAAGAACTGCGACTCGGA
ATGGCGCTCGCTTGGATAGCATTCGCTGCAGCCTAGCGGATGCACTGCGT
CCGCGATCCGTGGACGTGCTGCTCTTCAATCCGCCCTATGTAGTCACCAG
TGACGAGGAGCTGCAGACGCAACAGTTCGATTCGCACAGCGAATCCTCAA
CGGATCGCAATCTGGTTTTCTCCTGGGCTGGTGGACAGGACGGGCGACGC
GTCACGGACATTCTACTCAAGCAATTGGATGACATTCTTTCGCCTCGAGG
CGTGCTCTACCTACTCCTGCTGCGGGAGAACAAGCCGGAGGAGATTATCA
AATACTTAGAGGGCCTCCAGTTCCGGGCTGTTAAGTTCATGGAGCGACGC
ATTCCTGGCGAGCATTTGTGCATACTGAAGGTCACCAGGTACTTGGCATC
ATCATGACTCGTGCAATAGCATCAAATTAAAGTTGTATTTTAATTAAAAG
ATAAACTTTTTTAGGCGTTTATTCTTAAATTTGATACTAAATAATATGGA
GAATAATTTTAATAAAAGTTGAAATAAATGAAAAAAAAAAAAAAAAAAA
GH13185.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 19:52:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG9960-RA | 1284 | CG9960-RA | 55..1284 | 1..1230 | 6150 | 100 | Plus |
snapin-RA | 1284 | snapin-RA | 55..1284 | 1..1230 | 6150 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:46:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 2758151..2759379 | 1229..1 | 6025 | 99.3 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:48:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:46:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 2758420..2759656 | 1237..1 | 6170 | 99.9 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:18:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 2758420..2759656 | 1237..1 | 6170 | 99.9 | Minus |
Blast to na_te.dros performed on 2019-03-16 12:46:56 has no hits.
GH13185.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:47:48 Download gff for
GH13185.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 2758150..2759379 | 1..1230 | 99 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:39:50 Download gff for
GH13185.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9960-RA | 1..675 | 433..1107 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:22:48 Download gff for
GH13185.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9960-RA | 1..675 | 433..1107 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 14:05:37 Download gff for
GH13185.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9960-RA | 1..675 | 433..1107 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:49:10 Download gff for
GH13185.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9960-RA | 1..675 | 433..1107 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:55:14 Download gff for
GH13185.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9960-RA | 1..675 | 433..1107 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:57:38 Download gff for
GH13185.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
snapin-RA | 55..1284 | 1..1230 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:22:48 Download gff for
GH13185.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
snapin-RA | 55..1284 | 1..1230 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 14:05:37 Download gff for
GH13185.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9960-RA | 22..1251 | 1..1230 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:49:10 Download gff for
GH13185.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
snapin-RA | 55..1284 | 1..1230 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:55:14 Download gff for
GH13185.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9960-RA | 22..1251 | 1..1230 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:47:48 Download gff for
GH13185.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 2758427..2759656 | 1..1230 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:47:48 Download gff for
GH13185.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 2758427..2759656 | 1..1230 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:47:48 Download gff for
GH13185.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 2758427..2759656 | 1..1230 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:05:37 Download gff for
GH13185.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 2758427..2759656 | 1..1230 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:25:46 Download gff for
GH13185.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 2758427..2759656 | 1..1230 | 100 | | Minus |
GH13185.pep2 Sequence
Translation from 9 to 413
> GH13185.pep2
MDSDSTVTSLEENTENFCTNPTRDILAEGITNLFKPTIERLDERVASTIQ
LQAELRGQLDALAAQLRDIEKAQSQIPEFADKVKELLNVKHKVTVISNVL
VTSQERLTGLHKLIEKEQRRRQALLDSALSTNIS*
GH13185.pep2 Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 12:18:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF13874-PA | 136 | GF13874-PA | 4..136 | 2..134 | 637 | 92.5 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 12:18:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG24495-PA | 134 | GG24495-PA | 1..134 | 1..134 | 684 | 100 | Plus |
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 12:18:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dgri\GH10569-PA | 136 | GH10569-PA | 4..136 | 2..134 | 631 | 91.7 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:08:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Snapin-PA | 134 | CG9958-PA | 1..134 | 1..134 | 652 | 100 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 12:18:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI22913-PA | 136 | GI22913-PA | 4..136 | 2..134 | 644 | 93.2 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 12:18:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL26447-PA | 136 | GL26447-PA | 4..136 | 2..134 | 645 | 94.7 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 12:18:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA17213-PA | 136 | GA17213-PA | 4..136 | 2..134 | 645 | 94.7 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 12:18:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM18203-PA | 134 | GM18203-PA | 1..134 | 1..134 | 678 | 99.3 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 12:18:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD22807-PA | 134 | GD22807-PA | 1..134 | 1..134 | 684 | 100 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 12:18:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ23460-PA | 136 | GJ23460-PA | 4..136 | 2..134 | 633 | 91 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 12:18:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK24481-PA | 136 | GK24481-PA | 4..136 | 2..134 | 614 | 88 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 12:18:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE15040-PA | 134 | GE15040-PA | 1..134 | 1..134 | 684 | 100 | Plus |
GH13185.hyp Sequence
Translation from 432 to 1106
> GH13185.hyp
METPYTDHLSPEDFEHVYEPAEDSFLLLDALEKDLEYLDRLQPSLCVELG
SGSGVIITALAKKLAGFSLCLATDINPKACNATRRTATRNGARLDSIRCS
LADALRPRSVDVLLFNPPYVVTSDEELQTQQFDSHSESSTDRNLVFSWAG
GQDGRRVTDILLKQLDDILSPRGVLYLLLLRENKPEEIIKYLEGLQFRAV
KFMERRIPGEHLCILKVTRYLASS*
GH13185.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:52:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG9960-PA | 224 | CG9960-PA | 1..224 | 1..224 | 1146 | 100 | Plus |
GH13185.pep Sequence
Translation from 432 to 1106
> GH13185.pep
METPYTDHLSPEDFEHVYEPAEDSFLLLDALEKDLEYLDRLQPSLCVELG
SGSGVIITALAKKLAGFSLCLATDINPKACNATRRTATRNGARLDSIRCS
LADALRPRSVDVLLFNPPYVVTSDEELQTQQFDSHSESSTDRNLVFSWAG
GQDGRRVTDILLKQLDDILSPRGVLYLLLLRENKPEEIIKYLEGLQFRAV
KFMERRIPGEHLCILKVTRYLASS*
GH13185.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:44:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF20002-PA | 222 | GF20002-PA | 1..222 | 1..222 | 877 | 77.9 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:44:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG24496-PA | 224 | GG24496-PA | 1..224 | 1..224 | 1107 | 94.6 | Plus |
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:44:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dgri\GH10570-PA | 220 | GH10570-PA | 1..217 | 1..219 | 791 | 75 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:41:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
HemK2-PA | 224 | CG9960-PA | 1..224 | 1..224 | 1146 | 100 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:44:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI22924-PA | 220 | GI22924-PA | 1..217 | 1..219 | 826 | 77.2 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:45:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL26448-PA | 226 | GL26448-PA | 1..223 | 1..219 | 775 | 74.9 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:45:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA28866-PA | 226 | GA28866-PA | 1..223 | 1..219 | 775 | 74.9 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:45:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM18204-PA | 224 | GM18204-PA | 1..224 | 1..224 | 1146 | 97.8 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:45:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD22808-PA | 224 | GD22808-PA | 1..224 | 1..224 | 1154 | 98.7 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:45:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ23471-PA | 224 | GJ23471-PA | 1..221 | 1..219 | 893 | 76.5 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:45:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK19357-PA | 217 | GK19357-PA | 1..214 | 1..219 | 857 | 73.1 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:45:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE15042-PA | 224 | GE15042-PA | 1..224 | 1..224 | 1107 | 94.6 | Plus |