Clone GH13304 Report

Search the DGRC for GH13304

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:133
Well:4
Vector:pOT2
Associated Gene/TranscriptPglym78-RA
Protein status:GH13304.pep: gold
Preliminary Size:1479
Sequenced Size:1152

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1721 2001-01-01 Release 2 assignment
CG1721 2001-07-04 Blastp of sequenced clone
CG1721 2003-01-01 Sim4 clustering to Release 3
Pglym78 2008-04-29 Release 5.5 accounting
Pglym78 2008-08-15 Release 5.9 accounting
Pglym78 2008-12-18 5.12 accounting

Clone Sequence Records

GH13304.complete Sequence

1152 bp (1152 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051464

> GH13304.complete
CCGGAGTCCAATCAGAGAAGGCACCGCATCTGCGCACTACGTTTTTCCAA
CAGAACGGCAATATCGCGGCCTGACAGCTGCGACCTTGGACGGCTCCCTT
GTAGGTCAAACTTCAGCAGAATTCCCACATATTGCAGTCGCAGCAAGGCG
GCAGCTTAAGAACGAGTACACAATTATCCGCAGAGTGATCAACGCAGCTA
AAATGGGCGGCAAGTACAAGATCGTGATGGTGCGCCACGGCGAGTCCGAG
TGGAACCAGAAGAATCAGTTCTGCGGCTGGTACGACGCCAACCTCAGCGA
AAAGGGTCAGGAGGAGGCCCTAGCCGCCGGCAAGGCCGTCAAGGATGCCG
GCCTGGAGTTCGATGTGGCCCACACCTCGGTGCTGACCCGCGCCCAGGTG
ACGCTGGCCAGCATCCTGAAGGCCAGTGGCCACAAGGAGATCCCCATCCA
GAAGACTTGGCGCCTGAACGAGCGCCACTACGGTGGACTCACTGGCCTGA
ACAAGGCCGAGACCGCCGCCAAGTACGGCGAGGCCCAGGTGCAGATCTGG
CGTCGCAGCTTCGACACCCCGCCACCACCGATGGAGCCGGGCCATCCGTA
CTACGAGAACATCGTCAAGGATCCCCGCTACGCCGAGGGTCCCAAGCCCG
AGGAGTTCCCCCAGTTCGAGTCCCTCAAGCTGACCATCGAACGCACACTG
CCCTACTGGAACGACGTCATCATTCCCCAGATGAAGGAGGGCAAGCGCAT
CCTGATCGCTGCCCACGGCAACAGCCTCCGTGGCATCGTCAAGCATTTAG
ACAACCTTTCTGAGGACGCCATCATGGCCCTAAATCTGCCCACGGGCATT
CCGTTCGTCTACGAGCTGGACGAGAACTTCAAGCCGGTGGTGTCCATGCA
GTTCCTCGGCGACGAGGAGACCGTGAAGAAGGCCATCGAGGCTGTGGCCG
CCCAGGGCAAGGCCAAGTAAGCACGCAGGCCACACCTCATGAGAATCCAC
TCAAATACGGCACAAGTCAGAGCATTCTGATTACGCTTCTGTTCAAGATG
TAGCCAATCCCATTCGTTGTTGTTGTTCGCGTAGCAGTAATTGGTTCATC
CCCACTACAGTTAATAAATAATTTATTATTACACTCAAAAAAAAAAAAAA
AA

GH13304.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:36:30
Subject Length Description Subject Range Query Range Score Percent Strand
Pglym78-RA 1514 Pglym78-RA 25..1162 1..1138 5690 100 Plus
Pglym78-RB 1487 Pglym78-RB 1..1135 4..1138 5675 100 Plus
Pglym78-RC 1487 Pglym78-RC 1..1135 4..1138 5675 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:05:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 24971882..24972380 305..803 2465 99.6 Plus
chr3R 27901430 chr3R 24972440..24972772 804..1136 1635 99.4 Plus
chr3R 27901430 chr3R 24971107..24971413 1..307 1490 99 Plus
chr3R 27901430 chr3R 8057195..8057954 968..209 1220 77.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:49:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:05:11
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29149008..29149506 305..803 2495 100 Plus
3R 32079331 3R 29149569..29149903 804..1138 1675 100 Plus
3R 32079331 3R 29148248..29148554 1..307 1535 100 Plus
3R 32079331 3R 12231801..12232560 968..209 1220 77.4 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:58:05
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 28889839..28890337 305..803 2495 100 Plus
3R 31820162 3R 28890400..28890734 804..1138 1675 100 Plus
3R 31820162 3R 28889079..28889385 1..307 1535 100 Plus
3R 31820162 3R 11972632..11972956 968..644 665 80.3 Minus
3R 31820162 3R 11973198..11973391 402..209 400 80.4 Minus
3R 31820162 3R 11973014..11973142 586..458 330 83.7 Minus
Blast to na_te.dros performed on 2019-03-16 17:05:11 has no hits.

GH13304.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:06:35 Download gff for GH13304.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 24971107..24971411 1..305 99 -> Plus
chr3R 24971883..24972380 306..803 99 -> Plus
chr3R 24972440..24972740 804..1104 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:40:11 Download gff for GH13304.complete
Subject Subject Range Query Range Percent Splice Strand
Pglym78-RC 1..768 203..970 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:27:16 Download gff for GH13304.complete
Subject Subject Range Query Range Percent Splice Strand
Pglym78-RC 1..768 203..970 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:51:14 Download gff for GH13304.complete
Subject Subject Range Query Range Percent Splice Strand
Pglym78-RA 1..768 203..970 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:00:29 Download gff for GH13304.complete
Subject Subject Range Query Range Percent Splice Strand
Pglym78-RC 1..768 203..970 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:50:07 Download gff for GH13304.complete
Subject Subject Range Query Range Percent Splice Strand
Pglym78-RA 1..768 203..970 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:26:41 Download gff for GH13304.complete
Subject Subject Range Query Range Percent Splice Strand
Pglym78-RA 1..1136 1..1136 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:27:16 Download gff for GH13304.complete
Subject Subject Range Query Range Percent Splice Strand
Pglym78-RA 1..1136 1..1136 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:51:14 Download gff for GH13304.complete
Subject Subject Range Query Range Percent Splice Strand
Pglym78-RA 1..1136 1..1136 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:00:29 Download gff for GH13304.complete
Subject Subject Range Query Range Percent Splice Strand
Pglym78-RA 1..1136 1..1136 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:50:07 Download gff for GH13304.complete
Subject Subject Range Query Range Percent Splice Strand
Pglym78-RA 1..1136 1..1136 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:06:35 Download gff for GH13304.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29148248..29148552 1..305 100 -> Plus
3R 29149009..29149506 306..803 100 -> Plus
3R 29149569..29149901 804..1136 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:06:35 Download gff for GH13304.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29148248..29148552 1..305 100 -> Plus
3R 29149009..29149506 306..803 100 -> Plus
3R 29149569..29149901 804..1136 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:06:35 Download gff for GH13304.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29148248..29148552 1..305 100 -> Plus
3R 29149009..29149506 306..803 100 -> Plus
3R 29149569..29149901 804..1136 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:51:14 Download gff for GH13304.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 24973970..24974274 1..305 100 -> Plus
arm_3R 24974731..24975228 306..803 100 -> Plus
arm_3R 24975291..24975623 804..1136 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:38:21 Download gff for GH13304.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28889079..28889383 1..305 100 -> Plus
3R 28889840..28890337 306..803 100 -> Plus
3R 28890400..28890732 804..1136 100   Plus

GH13304.hyp Sequence

Translation from 1 to 969

> GH13304.hyp
RSPIREGTASAHYVFPTERQYRGLTAATLDGSLVGQTSAEFPHIAVAARR
QLKNEYTIIRRVINAAKMGGKYKIVMVRHGESEWNQKNQFCGWYDANLSE
KGQEEALAAGKAVKDAGLEFDVAHTSVLTRAQVTLASILKASGHKEIPIQ
KTWRLNERHYGGLTGLNKAETAAKYGEAQVQIWRRSFDTPPPPMEPGHPY
YENIVKDPRYAEGPKPEEFPQFESLKLTIERTLPYWNDVIIPQMKEGKRI
LIAAHGNSLRGIVKHLDNLSEDAIMALNLPTGIPFVYELDENFKPVVSMQ
FLGDEETVKKAIEAVAAQGKAK*

GH13304.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:40:54
Subject Length Description Subject Range Query Range Score Percent Strand
Pglym78-PC 255 CG1721-PC 1..255 68..322 1345 100 Plus
Pglym78-PB 255 CG1721-PB 1..255 68..322 1345 100 Plus
Pglym78-PA 255 CG1721-PA 1..255 68..322 1345 100 Plus
Pglym87-PA 292 CG17645-PA 36..292 66..322 1044 75.1 Plus
CG7059-PC 253 CG7059-PC 6..252 73..319 501 41.4 Plus

GH13304.pep Sequence

Translation from 202 to 969

> GH13304.pep
MGGKYKIVMVRHGESEWNQKNQFCGWYDANLSEKGQEEALAAGKAVKDAG
LEFDVAHTSVLTRAQVTLASILKASGHKEIPIQKTWRLNERHYGGLTGLN
KAETAAKYGEAQVQIWRRSFDTPPPPMEPGHPYYENIVKDPRYAEGPKPE
EFPQFESLKLTIERTLPYWNDVIIPQMKEGKRILIAAHGNSLRGIVKHLD
NLSEDAIMALNLPTGIPFVYELDENFKPVVSMQFLGDEETVKKAIEAVAA
QGKAK*

GH13304.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:02:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23292-PA 255 GF23292-PA 1..255 1..255 1344 98 Plus
Dana\GF17736-PA 288 GF17736-PA 36..288 3..255 972 68.8 Plus
Dana\GF18444-PA 265 GF18444-PA 18..265 6..253 514 41.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:02:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11648-PA 255 GG11648-PA 1..255 1..255 1360 99.6 Plus
Dere\GG17149-PA 292 GG17149-PA 42..292 5..255 1054 75.7 Plus
Dere\GG11129-PA 267 GG11129-PA 15..266 1..252 540 42.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:02:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23221-PA 255 GH23221-PA 1..255 1..255 1334 97.3 Plus
Dgri\GH14297-PA 255 GH14297-PA 1..255 1..255 1334 97.3 Plus
Dgri\GH15422-PA 247 GH15422-PA 1..247 9..255 968 69.2 Plus
Dgri\GH13344-PA 265 GH13344-PA 18..264 6..252 524 41.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:48:44
Subject Length Description Subject Range Query Range Score Percent Strand
Pglym78-PC 255 CG1721-PC 1..255 1..255 1345 100 Plus
Pglym78-PB 255 CG1721-PB 1..255 1..255 1345 100 Plus
Pglym78-PA 255 CG1721-PA 1..255 1..255 1345 100 Plus
Pglym87-PA 292 CG17645-PA 40..292 3..255 1042 75.9 Plus
CG7059-PC 253 CG7059-PC 6..252 6..252 501 41.4 Plus
CG7059-PD 262 CG7059-PD 15..261 6..252 501 41.4 Plus
CG7059-PA 267 CG7059-PA 20..266 6..252 501 41.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:02:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23192-PA 255 GI23192-PA 1..255 1..255 1249 96.1 Plus
Dmoj\GI10280-PA 293 GI10280-PA 42..293 4..255 1070 75.4 Plus
Dmoj\GI22381-PA 268 GI22381-PA 16..267 1..252 541 41.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:02:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23914-PA 255 GL23914-PA 1..255 1..255 1328 96.9 Plus
Dper\GL21564-PA 309 GL21564-PA 57..309 3..255 1036 73.9 Plus
Dper\GL24208-PA 267 GL24208-PA 20..266 6..252 508 42.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:02:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14392-PA 255 GA14392-PA 1..255 1..255 1328 96.9 Plus
Dpse\GA14593-PA 290 GA14593-PA 38..290 3..255 1041 74.3 Plus
Dpse\GA20068-PA 267 GA20068-PA 20..266 6..252 508 42.2 Plus
Dpse\GA20068-PB 252 GA20068-PB 5..251 6..252 507 42.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:02:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12771-PA 255 GM12771-PA 1..255 1..255 1358 99.6 Plus
Dsec\GM26030-PA 292 GM26030-PA 40..292 3..255 1072 76.3 Plus
Dsec\GM26427-PA 267 GM26427-PA 15..266 1..252 531 41.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:02:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20588-PA 341 GD20588-PA 40..292 3..255 1056 74.7 Plus
Dsim\GD21420-PA 429 GD21420-PA 1..112 1..112 598 99.1 Plus
Dsim\GD20944-PA 267 GD20944-PA 15..266 1..252 528 41.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:02:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14508-PA 255 GJ14508-PA 1..255 1..255 1326 96.9 Plus
Dvir\GJ11087-PA 299 GJ11087-PA 48..299 4..255 1067 76.2 Plus
Dvir\GJ24414-PA 265 GJ24414-PA 13..264 1..252 522 41.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:02:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11893-PA 255 GK11893-PA 1..255 1..255 1330 96.9 Plus
Dwil\GK11561-PA 287 GK11561-PA 34..287 3..255 1014 72.4 Plus
Dwil\GK14265-PA 267 GK14265-PA 20..267 6..253 553 43.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:02:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Pglym78-PA 255 GE23839-PA 1..255 1..255 1350 98.8 Plus
Dyak\GE24538-PA 292 GE24538-PA 40..292 3..255 1056 75.1 Plus
Dyak\GE10295-PA 253 GE10295-PA 1..252 1..252 524 41.3 Plus