Clone GH13851 Report

Search the DGRC for GH13851

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:138
Well:51
Vector:pOT2
Associated Gene/TranscriptOdc1-RA
Protein status:GH13851.pep: gold
Preliminary Size:1274
Sequenced Size:1300

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8721 2001-01-01 Release 2 assignment
CG8721 2002-03-19 Blastp of sequenced clone
CG8721 2003-01-01 Sim4 clustering to Release 3
Odc1 2008-04-29 Release 5.5 accounting
Odc1 2008-08-15 Release 5.9 accounting
Odc1 2008-12-18 5.12 accounting

Clone Sequence Records

GH13851.complete Sequence

1300 bp (1300 high quality bases) assembled on 2002-03-19

GenBank Submission: AY094710

> GH13851.complete
CCGCGTCTCGAGCGCCCCACTCACTCACTCAGTTGAGATCTTTCCGAGAT
GGCGGCCGCTACCCCTGAAATCCAGTTCTACGAACGCGAGCTCAACATCC
GCCGGGTGATCGAGGAGTGCGACCTGCAGCGCCTGGACCAGGCCCTCAAC
ATCTGCGACCTGTCTAGCGTGGAGCGTAAGCTGCGCCTCTGGCAGAAGCT
CCTGCCCAGGATCAAGCCCTTCTACGCCGTCAAGTGCAATGACGATCCAA
TGGTGGTCAGGCTGCTGGCCCAGCTGGGAGCCGGATTCGACTGCGCCTCC
AAAAACGAAGTCAAGCTGGTCTTGGGCTTCGATGTCTCGCCGGAGCGTAT
CATCTTCGCCAATCCCTGCCGCCCTGTCAGCCATCTGGAGTACGCCAAGG
AGCACCAGGTGTCCAACGGAACGGTGGACAATGAGTTCGAGGTATACAAG
CTGCACACGCACTATCCCAACTCCAACCTGATCGTGAGATTCAAGAGCGA
GGCCAAGGAGGCACAGTGCCCACTGGGCGACAAATTTGGCTGTGATGCGG
ATGTGGATGCAGCGGCCCTAATGCTGCTGGCCAAATCCTTGGAGCTGAAG
GTGACCGGCACCAGTTTCCACGTCGGCTCCGGATGCAGCGAGCTGCAGGC
CTACGATCGGGCCATCAAGAAGGCCAAGAACCTCTTCAAGTTCGGCGCAC
TACTGGGCTATGACATGGACTTTCTGGACATTGGCGGTGGGTTCCCTGGC
AGCGATGACGTAAAGTTTGAGAAGATAGCCGAAAGTGTGAATACCTCGGT
GCAGCGTCATTTTCCCGACGAACGCGTTCACATAATCGCCGAACCAGGAC
GCTTCTTTGTGGCGGCAGCCTGCACCTTGGTTTGCAAGATCCACGCCAAG
CGGGAGATCAGGAACGAAGCTGGCAAACTGGACACCGTAATGTACTATCT
GAATGACGGCGTCTATGGGTCCTTCAACTGCATTCTGTACGACCATCAAG
TGGTGATTGCAGAGCATTATCTGGACAATGCAGAATCTTTGCCACACCTA
AAGTCCTTGATTTGGGGGCCAAGTTGTGACGCCCTAGATAAGATTTCGGA
GGACCTGCACTTGCCCAACCTAAACCGAGGCGATCTTTTGGGATTCCGAA
ACATGGGCGCCTACACCATGCCCATTGCCAGTGCATTCAATGGATTCGAA
GTCCCCAAGACCCTGTACTTCCAAGCTATATGACTAAATCACTTACTCAA
TCCAATAAAACCAACATTTTGTGGAAAAAAAAAAAAAAAAAAAAAAAAAA

GH13851.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:22:15
Subject Length Description Subject Range Query Range Score Percent Strand
Odc1-RA 1413 Odc1-RA 104..1378 1..1275 6375 100 Plus
Odc2-RA 1313 Odc2-RA 101..710 88..697 1295 80.8 Plus
Odc2.a 1231 Odc2.a 40..428 88..476 775 79.9 Plus
Odc2.a 1231 Odc2.a 430..628 499..697 470 82.4 Plus
Odc2-RA 1313 Odc2-RA 852..969 839..956 245 80.5 Plus
Odc2-RA 1313 Odc2-RA 1052..1222 1039..1212 245 77 Plus
Odc2.a 1231 Odc2.a 770..887 839..956 245 80.5 Plus
Odc2.a 1231 Odc2.a 970..1140 1039..1212 245 77 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:23:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 3892223..3892542 1..320 1570 99.4 Plus
chr2R 21145070 chr2R 3893044..3893346 472..774 1500 99.7 Plus
chr2R 21145070 chr2R 3893402..3893653 773..1024 1260 100 Plus
chr2R 21145070 chr2R 3893909..3894092 1091..1274 920 100 Plus
chr2R 21145070 chr2R 3892835..3892993 318..476 795 100 Plus
chr2R 21145070 chr2R 3895412..3895637 472..697 530 82.3 Plus
chr2R 21145070 chr2R 3894722..3894954 88..320 520 81.5 Plus
chr2R 21145070 chr2R 3893782..3893851 1023..1092 350 100 Plus
chr2R 21145070 chr2R 3895225..3895364 337..476 280 80 Plus
chr2R 21145070 chr2R 3895837..3895954 839..956 245 80.5 Plus
chr2R 21145070 chr2R 3896281..3896392 1101..1212 230 80.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:50:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:23:17
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8004803..8005122 1..320 1600 100 Plus
2R 25286936 2R 8005624..8005926 472..774 1500 99.7 Plus
2R 25286936 2R 8005982..8006233 773..1024 1260 100 Plus
2R 25286936 2R 8006489..8006673 1091..1275 925 100 Plus
2R 25286936 2R 8005415..8005573 318..476 795 100 Plus
2R 25286936 2R 8007993..8008218 472..697 530 82.3 Plus
2R 25286936 2R 8007303..8007535 88..320 520 81.5 Plus
2R 25286936 2R 8006362..8006431 1023..1092 350 100 Plus
2R 25286936 2R 8007806..8007945 337..476 280 80 Plus
2R 25286936 2R 8008418..8008535 839..956 245 80.5 Plus
2R 25286936 2R 8008862..8008973 1101..1212 215 79.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:51:40
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 8006002..8006321 1..320 1600 100 Plus
2R 25260384 2R 8006823..8007125 472..774 1500 99.6 Plus
2R 25260384 2R 8007181..8007432 773..1024 1260 100 Plus
2R 25260384 2R 8007688..8007872 1091..1275 925 100 Plus
2R 25260384 2R 8006614..8006772 318..476 795 100 Plus
2R 25260384 2R 8009192..8009417 472..697 530 82.3 Plus
2R 25260384 2R 8008502..8008734 88..320 520 81.5 Plus
2R 25260384 2R 8007561..8007630 1023..1092 350 100 Plus
2R 25260384 2R 8009005..8009144 337..476 280 80 Plus
2R 25260384 2R 8009617..8009734 839..956 245 80.5 Plus
2R 25260384 2R 8010061..8010172 1101..1212 215 79.4 Plus
Blast to na_te.dros performed on 2019-03-15 17:23:18 has no hits.

GH13851.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:24:23 Download gff for GH13851.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 3893049..3893346 477..774 100 -> Plus
chr2R 3893404..3893652 775..1023 100 -> Plus
chr2R 3893783..3893851 1024..1092 100 -> Plus
chr2R 3892223..3892540 1..318 99 -> Plus
chr2R 3892836..3892993 319..476 100 -> Plus
chr2R 3893911..3894092 1093..1274 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:40:59 Download gff for GH13851.complete
Subject Subject Range Query Range Percent Splice Strand
Odc1-RA 1..1185 49..1233 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:30:57 Download gff for GH13851.complete
Subject Subject Range Query Range Percent Splice Strand
Odc1-RA 1..1185 49..1233 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:34:10 Download gff for GH13851.complete
Subject Subject Range Query Range Percent Splice Strand
Odc1-RA 1..1185 49..1233 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:04:23 Download gff for GH13851.complete
Subject Subject Range Query Range Percent Splice Strand
Odc1-RA 1..1185 49..1233 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:35:46 Download gff for GH13851.complete
Subject Subject Range Query Range Percent Splice Strand
Odc1-RA 1..1185 49..1233 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:57:04 Download gff for GH13851.complete
Subject Subject Range Query Range Percent Splice Strand
Odc1-RA 1..1274 1..1274 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:30:57 Download gff for GH13851.complete
Subject Subject Range Query Range Percent Splice Strand
Odc1-RA 1..1274 1..1274 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:34:10 Download gff for GH13851.complete
Subject Subject Range Query Range Percent Splice Strand
Odc1-RA 1..1253 22..1274 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:04:23 Download gff for GH13851.complete
Subject Subject Range Query Range Percent Splice Strand
Odc1-RA 1..1274 1..1274 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:35:46 Download gff for GH13851.complete
Subject Subject Range Query Range Percent Splice Strand
Odc1-RA 1..1253 22..1274 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:24:23 Download gff for GH13851.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8004803..8005120 1..318 100 -> Plus
2R 8005416..8005573 319..476 100 -> Plus
2R 8005629..8005926 477..774 100 -> Plus
2R 8005984..8006232 775..1023 100 -> Plus
2R 8006363..8006431 1024..1092 100 -> Plus
2R 8006491..8006672 1093..1274 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:24:23 Download gff for GH13851.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8004803..8005120 1..318 100 -> Plus
2R 8005416..8005573 319..476 100 -> Plus
2R 8005629..8005926 477..774 100 -> Plus
2R 8005984..8006232 775..1023 100 -> Plus
2R 8006363..8006431 1024..1092 100 -> Plus
2R 8006491..8006672 1093..1274 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:24:23 Download gff for GH13851.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8004803..8005120 1..318 100 -> Plus
2R 8005416..8005573 319..476 100 -> Plus
2R 8005629..8005926 477..774 100 -> Plus
2R 8005984..8006232 775..1023 100 -> Plus
2R 8006363..8006431 1024..1092 100 -> Plus
2R 8006491..8006672 1093..1274 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:34:10 Download gff for GH13851.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3893996..3894177 1093..1274 100   Plus
arm_2R 3893134..3893431 477..774 100 -> Plus
arm_2R 3893489..3893737 775..1023 100 -> Plus
arm_2R 3893868..3893936 1024..1092 100 -> Plus
arm_2R 3892308..3892625 1..318 100 -> Plus
arm_2R 3892921..3893078 319..476 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:38:07 Download gff for GH13851.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8006828..8007125 477..774 100 -> Plus
2R 8007183..8007431 775..1023 100 -> Plus
2R 8007562..8007630 1024..1092 100 -> Plus
2R 8007690..8007871 1093..1274 100   Plus
2R 8006002..8006319 1..318 100 -> Plus
2R 8006615..8006772 319..476 100 -> Plus

GH13851.pep Sequence

Translation from 48 to 1232

> GH13851.pep
MAAATPEIQFYERELNIRRVIEECDLQRLDQALNICDLSSVERKLRLWQK
LLPRIKPFYAVKCNDDPMVVRLLAQLGAGFDCASKNEVKLVLGFDVSPER
IIFANPCRPVSHLEYAKEHQVSNGTVDNEFEVYKLHTHYPNSNLIVRFKS
EAKEAQCPLGDKFGCDADVDAAALMLLAKSLELKVTGTSFHVGSGCSELQ
AYDRAIKKAKNLFKFGALLGYDMDFLDIGGGFPGSDDVKFEKIAESVNTS
VQRHFPDERVHIIAEPGRFFVAAACTLVCKIHAKREIRNEAGKLDTVMYY
LNDGVYGSFNCILYDHQVVIAEHYLDNAESLPHLKSLIWGPSCDALDKIS
EDLHLPNLNRGDLLGFRNMGAYTMPIASAFNGFEVPKTLYFQAI*

GH13851.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:27:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13654-PA 396 GF13654-PA 1..394 1..394 1843 85.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:27:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23323-PA 396 GG23323-PA 1..396 1..394 2010 94.7 Plus
Dere\GG23324-PA 399 GG23324-PA 1..392 1..392 1484 71.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:27:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21896-PA 392 GH21896-PA 3..391 5..393 1655 76.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:16:32
Subject Length Description Subject Range Query Range Score Percent Strand
Odc1-PA 394 CG8721-PA 1..394 1..394 2073 100 Plus
Odc2-PA 393 CG8719-PA 8..392 8..393 1545 74.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:27:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20395-PA 392 GI20395-PA 3..392 5..394 1591 77.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:27:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11482-PA 395 GL11482-PA 1..395 1..394 1803 83.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:27:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21280-PA 395 GA21280-PA 1..395 1..394 1808 83.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:27:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11484-PA 114 GM11484-PA 1..91 1..91 365 73.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:27:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15360-PA 394 GD15360-PA 1..394 1..394 2072 98.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:27:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22122-PA 392 GJ22122-PA 6..392 8..394 1704 80.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:27:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21743-PA 397 GK21743-PA 9..397 7..394 1670 77.6 Plus
Dwil\GK14274-PA 812 GK14274-PA 496..800 90..393 1079 67.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:27:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19168-PA 394 GE19168-PA 1..394 1..394 2028 95.7 Plus
Dyak\GE19169-PA 394 GE19169-PA 1..393 1..393 1502 73.3 Plus

GH13851.hyp Sequence

Translation from 48 to 1232

> GH13851.hyp
MAAATPEIQFYERELNIRRVIEECDLQRLDQALNICDLSSVERKLRLWQK
LLPRIKPFYAVKCNDDPMVVRLLAQLGAGFDCASKNEVKLVLGFDVSPER
IIFANPCRPVSHLEYAKEHQVSNGTVDNEFEVYKLHTHYPNSNLIVRFKS
EAKEAQCPLGDKFGCDADVDAAALMLLAKSLELKVTGTSFHVGSGCSELQ
AYDRAIKKAKNLFKFGALLGYDMDFLDIGGGFPGSDDVKFEKIAESVNTS
VQRHFPDERVHIIAEPGRFFVAAACTLVCKIHAKREIRNEAGKLDTVMYY
LNDGVYGSFNCILYDHQVVIAEHYLDNAESLPHLKSLIWGPSCDALDKIS
EDLHLPNLNRGDLLGFRNMGAYTMPIASAFNGFEVPKTLYFQAI*

GH13851.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:45:28
Subject Length Description Subject Range Query Range Score Percent Strand
Odc1-PA 394 CG8721-PA 1..394 1..394 2073 100 Plus
Odc2-PA 393 CG8719-PA 8..392 8..393 1545 74.1 Plus