Clone GH13859 Report

Search the DGRC for GH13859

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:138
Well:59
Vector:pOT2
Associated Gene/TranscriptCG30281-RA
Protein status:GH13859.pep: gold
Preliminary Size:1231
Sequenced Size:1027

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6676 2001-01-01 Release 2 assignment
CG30281 2001-10-10 Blastp of sequenced clone
CG30281 2003-01-01 Sim4 clustering to Release 3
CG30281 2008-04-29 Release 5.5 accounting
CG30281 2008-08-15 Release 5.9 accounting
CG30281 2008-12-18 5.12 accounting

Clone Sequence Records

GH13859.complete Sequence

1027 bp (1027 high quality bases) assembled on 2001-10-10

GenBank Submission: AY060696

> GH13859.complete
CACGGAACAAGATCATGAATCTCTATTTGTTGTGTGTTTTAATTTTAAGC
GGTGGCAGCCTCTTGTCTACTGCTCAAAGCAATAAATTGGATCTAGTCTA
TAAGAAAGCTGAAAGCATGGTTTCCAGTTTAAAGATCAGGCTGGAAGAGC
TAAAACAGAGCTACAAGGAAATCACAGAAGAAAGAGGCAGTCATGAGACA
ATTAACCCATCCTCCTGTCTAGCTGCCGGAATCAACAGTAATGGCATCCA
TGTTATTGAAGTTCCGGGTCTGGAACCTTTTCCGGTTTATTGTGACACTC
GGCTGGCGGGATCTGGATGGACTGTAATTCAGCGACGACAGGATGGCAGT
GAAAACTTCTATCGCTGTTGGGAGGAGTATAGCCAAGGATTTGGGGAGCT
TAGCGGAGAATTCTTTATGGGTCTGGAAAAGCTACACTTCCTAACAACCG
CGGAGCCTTACGAGCTGTTTGTCTATATGGAAGATTTCAATGGAGTGGTA
CATGATGCTCGATACGAGGATTTTGCCATTGGGAATGCATCAGCGTCCTA
TGCGCTATCTGTTTTGGGTAAATACTCGGGAGACGCCGGTGATTCGTTAA
GGTACCACAAGGGAATGCCCTTCTCCACATTCGATCACGATGATACGGGT
CACGGATGCGCCAGGATTTATGTGGGGGCCTGGTGGTATGATCAGTGCCA
GAGGAGCAACCTCAATGGCCAATATTTGGAAGGAGGTCGATTCGAGCCGA
AGATGTCGGGTCGTGGAATCACCTGGATGAGCTGGCGTGGCTACGACTAC
GGCTACAAATTCGTACAAATGATGATCAGACCCAAGTGTTCCAACAACCT
ACGAAGGCAGGGCATGCAAAATGCCTTAAACGCCCATTGAATTCCACACC
GAAAACACCGAAGGGAAATCACTTTATTTCTTGATAAACACTATCAACAT
TTTGGGACTTTTATTTACAATTTGATAATAACCGTTTCCCGCTGATTTGT
TTGTTGTAAAAAAAAAAAAAAAAAAAA

GH13859.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:12:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG30281-RA 1007 CG30281-RA 1..1007 1..1007 5035 100 Plus
Vrp1-RI 2914 Vrp1-RI 157..196 1008..969 200 100 Minus
Vrp1.b 2948 Vrp1.b 149..188 1008..969 200 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:08:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 18001761..18002268 199..706 2435 98.6 Plus
chr2R 21145070 chr2R 18002323..18002625 705..1007 1455 98.7 Plus
chr2R 21145070 chr2R 18001433..18001559 1..127 590 97.6 Plus
chr2R 21145070 chr2R 18001607..18001684 121..198 360 97.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:50:07 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:08:13
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22115325..22115832 199..706 2540 100 Plus
2R 25286936 2R 22115887..22116190 705..1008 1520 100 Plus
2R 25286936 2R 22114997..22115123 1..127 635 100 Plus
2R 25286936 2R 22115171..22115248 121..198 375 98.7 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:36:13
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 22116524..22117031 199..706 2540 100 Plus
2R 25260384 2R 22117086..22117389 705..1008 1520 100 Plus
2R 25260384 2R 22116196..22116322 1..127 635 100 Plus
2R 25260384 2R 22116370..22116447 121..198 375 98.7 Plus
Blast to na_te.dros performed on 2019-03-16 20:08:13 has no hits.

GH13859.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:09:14 Download gff for GH13859.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 18001614..18001684 128..198 98 -> Plus
chr2R 18001433..18001559 1..127 97 -> Plus
chr2R 18001761..18002268 199..706 98 -> Plus
chr2R 18002325..18002625 707..1007 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:41:02 Download gff for GH13859.complete
Subject Subject Range Query Range Percent Splice Strand
CG30281-RA 1..876 15..890 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:52:09 Download gff for GH13859.complete
Subject Subject Range Query Range Percent Splice Strand
CG30281-RA 1..876 15..890 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:52:00 Download gff for GH13859.complete
Subject Subject Range Query Range Percent Splice Strand
CG30281-RA 1..876 15..890 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:21:21 Download gff for GH13859.complete
Subject Subject Range Query Range Percent Splice Strand
CG30281-RA 1..876 15..890 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:53:11 Download gff for GH13859.complete
Subject Subject Range Query Range Percent Splice Strand
CG30281-RA 1..876 15..890 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:37:09 Download gff for GH13859.complete
Subject Subject Range Query Range Percent Splice Strand
CG30281-RA 1..1007 1..1007 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:52:09 Download gff for GH13859.complete
Subject Subject Range Query Range Percent Splice Strand
CG30281-RA 1..1007 1..1007 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:52:00 Download gff for GH13859.complete
Subject Subject Range Query Range Percent Splice Strand
CG30281-RA 1..1007 1..1007 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:21:22 Download gff for GH13859.complete
Subject Subject Range Query Range Percent Splice Strand
CG30281-RA 1..1007 1..1007 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:53:11 Download gff for GH13859.complete
Subject Subject Range Query Range Percent Splice Strand
CG30281-RA 1..1007 1..1007 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:09:14 Download gff for GH13859.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22115889..22116189 707..1007 100   Plus
2R 22114997..22115123 1..127 100 -> Plus
2R 22115178..22115248 128..198 100 -> Plus
2R 22115325..22115832 199..706 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:09:14 Download gff for GH13859.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22115889..22116189 707..1007 100   Plus
2R 22114997..22115123 1..127 100 -> Plus
2R 22115178..22115248 128..198 100 -> Plus
2R 22115325..22115832 199..706 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:09:14 Download gff for GH13859.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22115889..22116189 707..1007 100   Plus
2R 22114997..22115123 1..127 100 -> Plus
2R 22115178..22115248 128..198 100 -> Plus
2R 22115325..22115832 199..706 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:52:00 Download gff for GH13859.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18002502..18002628 1..127 100 -> Plus
arm_2R 18002683..18002753 128..198 100 -> Plus
arm_2R 18002830..18003337 199..706 100 -> Plus
arm_2R 18003394..18003694 707..1007 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:58:02 Download gff for GH13859.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22116524..22117031 199..706 100 -> Plus
2R 22117088..22117388 707..1007 100   Plus
2R 22116196..22116322 1..127 100 -> Plus
2R 22116377..22116447 128..198 100 -> Plus

GH13859.hyp Sequence

Translation from 2 to 889

> GH13859.hyp
RNKIMNLYLLCVLILSGGSLLSTAQSNKLDLVYKKAESMVSSLKIRLEEL
KQSYKEITEERGSHETINPSSCLAAGINSNGIHVIEVPGLEPFPVYCDTR
LAGSGWTVIQRRQDGSENFYRCWEEYSQGFGELSGEFFMGLEKLHFLTTA
EPYELFVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKYSGDAGDSLR
YHKGMPFSTFDHDDTGHGCARIYVGAWWYDQCQRSNLNGQYLEGGRFEPK
MSGRGITWMSWRGYDYGYKFVQMMIRPKCSNNLRRQGMQNALNAH*

GH13859.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:46:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG30281-PA 291 CG30281-PA 1..291 5..295 1571 100 Plus
CG30280-PB 272 CG30280-PB 15..264 29..279 704 49.6 Plus
CG9500-PA 272 CG9500-PA 67..268 79..279 540 46.8 Plus
CG5550-PA 246 CG5550-PA 37..246 70..278 535 46.9 Plus
CG30280-PC 220 CG30280-PC 15..217 29..232 532 47.3 Plus

GH13859.pep Sequence

Translation from 14 to 889

> GH13859.pep
MNLYLLCVLILSGGSLLSTAQSNKLDLVYKKAESMVSSLKIRLEELKQSY
KEITEERGSHETINPSSCLAAGINSNGIHVIEVPGLEPFPVYCDTRLAGS
GWTVIQRRQDGSENFYRCWEEYSQGFGELSGEFFMGLEKLHFLTTAEPYE
LFVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKYSGDAGDSLRYHKG
MPFSTFDHDDTGHGCARIYVGAWWYDQCQRSNLNGQYLEGGRFEPKMSGR
GITWMSWRGYDYGYKFVQMMIRPKCSNNLRRQGMQNALNAH*

GH13859.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:31:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13288-PA 288 GF13288-PA 1..283 1..284 1125 72.6 Plus
Dana\GF19835-PA 256 GF19835-PA 7..250 24..277 714 53.3 Plus
Dana\GF12980-PA 268 GF12980-PA 11..264 29..274 601 46.1 Plus
Dana\GF12978-PA 248 GF12978-PA 30..244 65..274 566 50.2 Plus
Dana\GF12573-PA 434 GF12573-PA 210..422 66..280 537 48.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:31:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22162-PA 291 GG22162-PA 1..291 1..291 1398 89.4 Plus
Dere\GG22161-PA 288 GG22161-PA 14..280 6..275 695 46.9 Plus
Dere\GG23629-PA 277 GG23629-PA 72..273 75..275 547 48.8 Plus
Dere\GG10629-PA 417 GG10629-PA 164..407 35..280 535 44.4 Plus
Dere\GG20632-PA 246 GG20632-PA 37..246 66..274 516 45.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:31:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20551-PA 273 GH20551-PA 9..266 25..275 920 64.3 Plus
Dgri\GH20745-PA 242 GH20745-PA 31..240 65..273 614 54.5 Plus
Dgri\GH13721-PA 331 GH13721-PA 65..326 17..274 561 45.1 Plus
Dgri\GH23025-PA 253 GH23025-PA 36..253 66..278 554 51.6 Plus
Dgri\GH23023-PA 253 GH23023-PA 36..253 66..278 553 51.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:08:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG30281-PA 291 CG30281-PA 1..291 1..291 1571 100 Plus
CG30280-PD 288 CG30280-PD 31..280 25..275 704 49.6 Plus
CG9500-PB 292 CG9500-PB 87..288 75..275 540 46.8 Plus
CG5550-PA 246 CG5550-PA 37..246 66..274 535 46.9 Plus
CG8642-PB 429 CG8642-PB 176..419 35..280 532 44.4 Plus
CG5550-PB 250 CG5550-PB 37..250 66..274 520 46 Plus
CG1791-PC 333 CG1791-PC 137..329 84..273 432 46.7 Plus
CG1791-PA 334 CG1791-PA 138..330 84..273 432 46.7 Plus
CG6788-PA 358 CG6788-PA 86..356 8..274 427 34.6 Plus
CG1791-PB 195 CG1791-PB 1..191 86..273 426 46.7 Plus
CG31832-PB 227 CG31832-PB 21..225 64..274 419 42.7 Plus
CG1889-PC 332 CG1889-PC 117..331 63..276 384 39.3 Plus
CG1889-PA 332 CG1889-PA 117..331 63..276 384 39.3 Plus
CG1889-PD 338 CG1889-PD 123..337 63..276 384 39.3 Plus
CG41520-PD 627 CG41520-PD 403..615 69..274 378 40.6 Plus
CG41520-PA 745 CG41520-PA 521..733 69..274 378 40.6 Plus
CG10359-PG 459 CG10359-PG 243..449 65..273 360 41 Plus
CG10359-PE 485 CG10359-PE 269..475 65..273 360 41 Plus
sca-PB 799 CG17579-PB 517..749 32..283 339 33.5 Plus
sca-PA 799 CG17579-PA 517..749 32..283 339 33.5 Plus
CG41520-PB 729 CG41520-PB 521..717 69..274 323 36.9 Plus
CG9593-PB 382 CG9593-PB 134..370 51..273 312 34.3 Plus
CG7668-PC 422 CG7668-PC 183..420 24..273 284 34 Plus
CG7668-PA 422 CG7668-PA 183..420 24..273 284 34 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:31:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18820-PA 211 GI18820-PA 2..210 73..281 796 66 Plus
Dmoj\GI18819-PA 214 GI18819-PA 1..208 86..282 636 57.7 Plus
Dmoj\GI20830-PA 239 GI20830-PA 28..237 65..273 592 52.6 Plus
Dmoj\GI15676-PA 330 GI15676-PA 80..327 21..276 572 46.5 Plus
Dmoj\GI18379-PA 330 GI18379-PA 80..326 15..273 564 44.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:31:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11776-PA 236 GL11776-PA 2..226 59..282 967 76.4 Plus
Dper\GL26064-PA 458 GL26064-PA 200..452 21..279 538 43.8 Plus
Dper\GL26043-PA 453 GL26043-PA 207..451 33..274 537 42.5 Plus
Dper\GL25703-PA 356 GL25703-PA 146..354 65..274 506 46.8 Plus
Dper\GL26079-PA 273 GL26079-PA 28..257 47..272 499 44.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:31:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15749-PA 293 GA15749-PA 1..283 1..282 1043 66.1 Plus
Dpse\GA24068-PA 281 GA24068-PA 9..277 6..277 771 52 Plus
Dpse\GA25261-PA 262 GA25261-PA 4..256 21..279 541 43.6 Plus
Dpse\GA25254-PA 366 GA25254-PA 120..364 33..274 527 42.1 Plus
Dpse\GA25394-PA 281 GA25394-PA 40..280 31..275 521 41.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:31:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15883-PA 292 GM15883-PA 1..292 1..291 1446 90.1 Plus
Dsec\GM15881-PA 288 GM15881-PA 14..280 6..275 690 47.6 Plus
Dsec\GM17946-PA 293 GM17946-PA 29..289 23..275 543 41.4 Plus
Dsec\GM20674-PA 418 GM20674-PA 165..408 35..280 531 44 Plus
Dsec\GM21726-PA 246 GM21726-PA 20..246 54..274 518 44.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:31:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11645-PA 292 GD11645-PA 1..292 1..291 1477 91.8 Plus
Dsim\GD11644-PA 288 GD11644-PA 14..280 6..275 697 48 Plus
Dsim\GD22585-PA 292 GD22585-PA 29..288 18..275 556 43.3 Plus
Dsim\GD11221-PA 246 GD11221-PA 20..246 54..274 522 45.2 Plus
Dsim\GD17373-PA 358 GD17373-PA 97..358 21..276 438 36.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:31:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21847-PA 226 GJ21847-PA 9..219 65..275 833 69.7 Plus
Dvir\GJ21846-PA 238 GJ21846-PA 4..217 65..275 705 57.9 Plus
Dvir\GJ20563-PA 242 GJ20563-PA 19..240 48..273 614 51.8 Plus
Dvir\GJ23826-PA 241 GJ23826-PA 31..241 65..274 583 53.1 Plus
Dvir\GJ12860-PA 287 GJ12860-PA 56..281 51..275 574 47.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:31:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21394-PA 313 GK21394-PA 1..277 1..279 970 63.1 Plus
Dwil\GK19386-PA 223 GK19386-PA 2..215 65..275 711 58.9 Plus
Dwil\GK20369-PA 234 GK20369-PA 19..229 66..274 641 54.7 Plus
Dwil\GK22020-PA 249 GK22020-PA 38..249 66..274 583 51.6 Plus
Dwil\GK15354-PA 258 GK15354-PA 1..255 1..275 552 41.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:31:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12242-PA 288 GE12242-PA 1..288 1..287 1394 88.9 Plus
Dyak\GE12241-PA 288 GE12241-PA 14..280 6..275 688 47.6 Plus
Dyak\GE22879-PA 418 GE22879-PA 166..409 35..280 544 45.2 Plus
Dyak\GE18450-PA 249 GE18450-PA 43..245 74..275 529 48.5 Plus
Dyak\GE11822-PA 246 GE11822-PA 20..246 54..274 511 44.3 Plus