Clone GH13924 Report

Search the DGRC for GH13924

Clone and Library Details

Library:GH
Tissue Source:Drosophila melanogaster head
Created by:Ling Hong
Date Registered:1998-06-02
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:139
Well:24
Vector:pOT2
Associated Gene/TranscriptCG2046-RA
Protein status:GH13924.pep: gold
Preliminary Size:761
Sequenced Size:854

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2046 2001-01-01 Release 2 assignment
CG2046 2002-03-19 Blastp of sequenced clone
CG2046 2003-01-01 Sim4 clustering to Release 3
CG2046 2008-04-29 Release 5.5 accounting
CG2046 2008-08-15 Release 5.9 accounting
CG2046 2008-12-18 5.12 accounting

Clone Sequence Records

GH13924.complete Sequence

854 bp (854 high quality bases) assembled on 2002-03-19

GenBank Submission: AY094711

> GH13924.complete
ATTAGTTTCACCTTTTTTATTAAATCAAAACAGACACGATGAGCTGTCCA
GGATTTGGAGAACTAAATATACCCTCGTCGCGTGCCTTCTGGGACGACTG
CGACGAGGATGAATTGGAGAACCTTAAGCCGGTGGAGAAGCTGCAGCTGA
AGTTTGATGATGATTGCGATGGGGAAGCTGCCCCTGTGGAGAGCGAGATG
CTGGTGGTCATTGAGGGCGTCAACGTCACTCACTTCGCCTCTTCTCTGCT
GGAAAAGGATGCAAAGCGTGTGTGCGCCATTCCTGCCAATAACTCGACCC
TGCACTGGAGTCATTCGTCCAAACAGTTGCTGGCCATAATCAACGAGGAC
CTGACCAGTAGCGGCGAGGTAGCGGAGCTCCTACTGCCGTACGTGAAGCT
TGCCAAGAAAGTGATCACTCTGACGCTTAAGCCAAAGGTCGAGTTCAAAA
GCGAGGACATCCAGCTCTACCGGGATCACATTGCCGTTGTCCGCGGCATA
GGTGCCAACCAGAAGGATATCACTGAACTAGAGGCTCCCAACTTTATCGC
TGGAGTTGCAGCAGGCGTTGCCAGTTGGCGGGATCAGATGGAATTGCCTG
TTACCTCTTTCGTTATTTACACCGACAAGCTGCCCCTCGACGCCACAGCT
GCGCAGCCAGTGATCAAGGTACTTAAAGCCGCGGGCGTTGCCTGCAGCTC
GAGCTACATCCCTCCGCGGAAGGAGAGCTCTTATTTGTACATGTGAAACT
ACTTTTGGCTGTGCTCAACTTCCTAGTTTTAATGCTTGTAAAAATGATAC
GGTTGCGGAATAAAAATCGAACTACTTAAGTACATCAAAAAAAAAAAAAA
AAAA

GH13924.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:22:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG2046-RA 999 CG2046-RA 156..996 1..841 4205 100 Plus
CG2046.a 905 CG2046.a 72..905 1..841 4075 99.1 Plus
CG1218-RA 1498 CG1218-RA 1418..1498 841..761 405 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:41:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 1619288..1619715 567..140 2140 100 Minus
chr3R 27901430 chr3R 1618955..1619224 836..567 1350 100 Minus
chr3R 27901430 chr3R 1619768..1619907 140..1 700 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:50:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:41:27
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5793641..5794068 567..140 2140 100 Minus
3R 32079331 3R 5793303..5793577 841..567 1375 100 Minus
3R 32079331 3R 5794121..5794260 140..1 700 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:51:40
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 5534472..5534899 567..140 2140 100 Minus
3R 31820162 3R 5534134..5534408 841..567 1375 100 Minus
3R 31820162 3R 5534952..5535091 140..1 700 100 Minus
Blast to na_te.dros performed 2019-03-16 23:41:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsil\Loa 7779 Dsil\Loa DSV28T24 7779bp AKA(S39346) Derived from X60177 (Rel. 37, Last updated, Version 8). 1743..1806 275..336 116 68.8 Plus

GH13924.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:42:27 Download gff for GH13924.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 1618955..1619223 568..836 100 <- Minus
chr3R 1619288..1619715 140..567 100 <- Minus
chr3R 1619769..1619907 1..139 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 16:41:12 Download gff for GH13924.complete
Subject Subject Range Query Range Percent Splice Strand
CG2046-RA 1..708 39..746 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:30:59 Download gff for GH13924.complete
Subject Subject Range Query Range Percent Splice Strand
CG2046-RA 1..708 39..746 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:47:27 Download gff for GH13924.complete
Subject Subject Range Query Range Percent Splice Strand
CG2046-RA 1..708 39..746 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:04:24 Download gff for GH13924.complete
Subject Subject Range Query Range Percent Splice Strand
CG2046-RA 1..708 39..746 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:55:31 Download gff for GH13924.complete
Subject Subject Range Query Range Percent Splice Strand
CG2046-RA 1..708 39..746 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:57:06 Download gff for GH13924.complete
Subject Subject Range Query Range Percent Splice Strand
CG2046-RA 72..907 1..836 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:30:59 Download gff for GH13924.complete
Subject Subject Range Query Range Percent Splice Strand
CG2046-RA 72..907 1..836 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:47:27 Download gff for GH13924.complete
Subject Subject Range Query Range Percent Splice Strand
CG2046-RA 58..893 1..836 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:04:24 Download gff for GH13924.complete
Subject Subject Range Query Range Percent Splice Strand
CG2046-RA 72..907 1..836 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:55:31 Download gff for GH13924.complete
Subject Subject Range Query Range Percent Splice Strand
CG2046-RA 58..893 1..836 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:42:27 Download gff for GH13924.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5793308..5793576 568..836 100 <- Minus
3R 5793641..5794068 140..567 100 <- Minus
3R 5794122..5794260 1..139 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:42:27 Download gff for GH13924.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5793308..5793576 568..836 100 <- Minus
3R 5793641..5794068 140..567 100 <- Minus
3R 5794122..5794260 1..139 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:42:27 Download gff for GH13924.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5793308..5793576 568..836 100 <- Minus
3R 5793641..5794068 140..567 100 <- Minus
3R 5794122..5794260 1..139 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:47:27 Download gff for GH13924.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1619030..1619298 568..836 100 <- Minus
arm_3R 1619363..1619790 140..567 100 <- Minus
arm_3R 1619844..1619982 1..139 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:38:08 Download gff for GH13924.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5534139..5534407 568..836 100 <- Minus
3R 5534472..5534899 140..567 100 <- Minus
3R 5534953..5535091 1..139 100   Minus

GH13924.pep Sequence

Translation from 38 to 745

> GH13924.pep
MSCPGFGELNIPSSRAFWDDCDEDELENLKPVEKLQLKFDDDCDGEAAPV
ESEMLVVIEGVNVTHFASSLLEKDAKRVCAIPANNSTLHWSHSSKQLLAI
INEDLTSSGEVAELLLPYVKLAKKVITLTLKPKVEFKSEDIQLYRDHIAV
VRGIGANQKDITELEAPNFIAGVAAGVASWRDQMELPVTSFVIYTDKLPL
DATAAQPVIKVLKAAGVACSSSYIPPRKESSYLYM*

GH13924.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:27:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18645-PA 235 GF18645-PA 1..235 1..235 950 72.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:27:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10821-PA 235 GG10821-PA 1..235 1..235 1142 91.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:27:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19435-PA 235 GH19435-PA 1..235 1..235 737 58.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:00:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG2046-PA 235 CG2046-PA 1..235 1..235 1202 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:27:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22638-PA 235 GI22638-PA 1..235 1..235 789 62 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:27:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23009-PA 52 GL23009-PA 1..42 1..42 192 78.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:27:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15203-PA 235 GA15203-PA 1..235 1..235 910 69.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:27:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10589-PA 235 GM10589-PA 1..235 1..235 1210 96.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:27:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19580-PA 235 GD19580-PA 1..235 1..235 1210 96.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:27:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23885-PA 235 GJ23885-PA 1..235 1..235 780 59.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:27:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13860-PA 233 GK13860-PA 1..233 1..235 844 65.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:27:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24135-PA 235 GE24135-PA 1..235 1..235 1114 88.5 Plus

GH13924.hyp Sequence

Translation from 38 to 745

> GH13924.hyp
MSCPGFGELNIPSSRAFWDDCDEDELENLKPVEKLQLKFDDDCDGEAAPV
ESEMLVVIEGVNVTHFASSLLEKDAKRVCAIPANNSTLHWSHSSKQLLAI
INEDLTSSGEVAELLLPYVKLAKKVITLTLKPKVEFKSEDIQLYRDHIAV
VRGIGANQKDITELEAPNFIAGVAAGVASWRDQMELPVTSFVIYTDKLPL
DATAAQPVIKVLKAAGVACSSSYIPPRKESSYLYM*

GH13924.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:47:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG2046-PA 235 CG2046-PA 1..235 1..235 1202 100 Plus